noise reduction ear protection

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The plugs is capable to cancel up to 33 dB of noi...

... of the Muffs ANSI specification Description of Electronic Muffs : ①Fit to Human body leather material, comfortable experienc...

Product Description Product name Wired Over Ear gaming Headphone Noise reduction ear pads and DC jack USB connector for PS4 Material ABS, Aluminium or...

... Fire Wall Panel Pet Felt 100% Polyester Fibre Acoustic Panel Product type Polyester fiber panel/PET sound absorbing pane...

..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc....

...both plastic and aluminum, manufactured by our trusted Aluminum bracket factory to ensure the highest quality and durability. In addition to sun an...

Company Profile *, *::before, *::after {box-sizing: border-box;}* {margin: 0;}html, body {height: 100%;}body {line-height: 1.5;-webkit-font-smoothing:...

... Function Reduce Harmful Type In- Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

... earmuffs, match the bluetooth music glasses are perfect group. When you listening to music, wear the earmuffs, you ...

..., TWS smart headphones will play an important role in the fields of wireless connection, voice interaction, intelligent , health mon...

... Plugs Protector Reusable Hing plugs muff Features: Reduce the can be reduced NRR: 24dB; SNR: 25d...

... Product Description: Headphone Earpads provide excellent and comfort for users. It comes with multi-color choice, s...

... filter Earmuff NRR 31dB Size suit for adlut,easy to adjust Color Black,red,blue or others Function Reduce the to the MOQ 1000PCS...

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather pad with memory foam for comfortable we...

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather pad with memory foam for comfortable we...

... XY-50 TWS bluetooth phone with charge case sensor buds bluetooth 3 pairs free tips freebuds ANC tws buds With a d...

... Article No.: B09 Split buds Wireless buds with immersive sound, active Features Immersive sound Premium speaker drivers deli...

... Super Effective Hing Assist - Ideal for most mild to moderate hing loss. With , these small devices will bring...

... phones HiFi Stereo In Headphone ENC ANC Call Audio Buds Feature: Product Name: Wireless buds Bluetooth XY-70 [Bluetooth ...