noise reduction foam

Recommend Insulation Boards Heat Resistant Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity...

Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding c...

...dustproof sealing, shock absorption resistance and . Suitable for electronic products, automotive parts, precision industrial equipm...

...formed by the of polysiloxane, retaining the excellent properties of silicone polymers, such as resistance to high and low temperatures, ul...

... 3510 PO ) is a product obtained through the processes of blending polyethylene with ing agents and auxiliaries, followed by extrusion...

... Silicone Ear Plugs 31.5 X 12.5mm With Nylon PVC Cord Product Overview Safety silicone earplugs with nylon or PVC cord for superior ear protec...

... Sheet Pipe Manufacturing Line for and Vibration Absorption Product Overview Huashida's Rubber Insulation Tube/Sheet Produ...

... Underlay 200sqft/roll Underlayment The Green IXPE flooring underlayment is 2mm thick and will provide you with the best p...

... comfort, and provide moisture protection for various flooring systems. Manufactured from premium Ethylene Vinyl Acetate (EVA) , this flooring ...

...IXPE For Wood Floor Comfort Step And Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and...

... Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU (Latex free and ...

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

... knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with...

... Function Reduce Harmful Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

...vehicle, such as the doors, floor, roof, and firewall. Their strategic placement and combination can effectively minimize and improve overall...

Aluminum Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functi...

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose ...

... Rubber Weather Stripping Epdm Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile ...