Recommend Insulation Boards Heat Resistant Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity...
Add to Cart
Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding c...
Add to Cart
...dustproof sealing, shock absorption resistance and . Suitable for electronic products, automotive parts, precision industrial equipm...
Add to Cart
... Underlay 200sqft/roll Underlayment The Green IXPE flooring underlayment is 2mm thick and will provide you with the best p...
Add to Cart
3 - 12mm Thickness Fire Retardant Insulation Acoustic Irradiated cross-linked polyethylene (IXPE ) is very fine celled m...
Add to Cart
...IXPE For Wood Floor Comfort Step And Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and...
Add to Cart
... Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU (Latex free and ...
Add to Cart
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...
Add to Cart
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...
Add to Cart
... knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with...
Add to Cart
... Function Reduce Harmful Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...
Add to Cart
Aluminum Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functi...
Add to Cart
... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose ...
Add to Cart
... Rubber Weather Stripping Epdm Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile ...
Add to Cart
... canceling earmuffs passive reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in th...
Add to Cart
... of ear canal, ensuring a better sealing, maximum and optimal hearing protection. Performance Earplug dispenser with earplugs, the ...
Add to Cart
... of roads, highways, elevated composite roads and other sources. It is divided into a purely sound-reflecting reflective sound barr...
Add to Cart
... Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep ...
Add to Cart
Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for...
Add to Cart