China Categories
English
1 - 20 Results for noise reduction foam from 7832 Products

Recommend Insulation Boards Heat Resistant Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity...

Time : Apr,03,2026
Contact Now

Add to Cart

Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding c...

Time : Apr,03,2026
Contact Now

Add to Cart

...dustproof sealing, shock absorption resistance and . Suitable for electronic products, automotive parts, precision industrial equipm...

Time : Apr,03,2026
Contact Now

Add to Cart

... Underlay 200sqft/roll Underlayment The Green IXPE flooring underlayment is 2mm thick and will provide you with the best p...

Time : Dec,09,2024
Contact Now

Add to Cart

3 - 12mm Thickness Fire Retardant Insulation Acoustic Irradiated cross-linked polyethylene (IXPE ) is very fine celled m...

Time : Dec,09,2024
Contact Now

Add to Cart

...IXPE For Wood Floor Comfort Step And Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and...

Time : Jul,08,2025
Contact Now

Add to Cart

... Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU (Latex free and ...

Time : Dec,09,2024
Contact Now

Add to Cart

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

Time : Dec,09,2024
Contact Now

Add to Cart

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

Time : Dec,09,2024
Contact Now

Add to Cart

... knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with...

Time : Apr,03,2026
Contact Now

Add to Cart

... Function Reduce Harmful Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

Time : Dec,09,2024
Contact Now

Add to Cart

Aluminum Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functi...

Time : Sep,30,2025
Contact Now

Add to Cart

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose ...

Time : Dec,09,2024
Contact Now

Add to Cart

... Rubber Weather Stripping Epdm Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile ...

Time : Mar,02,2026
Contact Now

Add to Cart

... canceling earmuffs passive reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in th...

Time : Apr,03,2026
Contact Now

Add to Cart

... of ear canal, ensuring a better sealing, maximum and optimal hearing protection. Performance Earplug dispenser with earplugs, the ...

Time : Dec,09,2024
Contact Now

Add to Cart

... of roads, highways, elevated composite roads and other sources. It is divided into a purely sound-reflecting reflective sound barr...

Time : Dec,09,2024
Contact Now

Add to Cart

... Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep ...

Time : Dec,09,2024
Contact Now

Add to Cart

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for...

Time : Apr,03,2026
Contact Now

Add to Cart

Inquiry Cart 0