China Categories
English
1 - 20 Results for foam noise reduction from 7555 Products

reflecting fireproof sound and heat insulation sheet materials ixpe foam for roof Closed Cell Cross Linked Rolls & Laminated Sheets Rolls, sheets and ...

Time : Jan,10,2026
Contact Now

Add to Cart

...dustproof sealing, shock absorption resistance and . Suitable for electronic products, automotive parts, precision industrial equipm...

Time : Jan,10,2026
Contact Now

Add to Cart

... Underlay 200sqft/roll Underlayment The Green IXPE flooring underlayment is 2mm thick and will provide you with the best p...

Time : Dec,09,2024
Contact Now

Add to Cart

...IXPE For Wood Floor Comfort Step And Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and...

Time : Jul,08,2025
Contact Now

Add to Cart

Recommend Insulation Boards Heat Resistant Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity...

Time : Jan,10,2026
Contact Now

Add to Cart

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

Time : Dec,09,2024
Contact Now

Add to Cart

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

Time : Dec,09,2024
Contact Now

Add to Cart

... Function Reduce Harmful Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

Time : Dec,09,2024
Contact Now

Add to Cart

Aluminum Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functi...

Time : Sep,30,2025
Contact Now

Add to Cart

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose ...

Time : Dec,09,2024
Contact Now

Add to Cart

... Rubber Weather Stripping Epdm Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile ...

Time : Feb,26,2025
Contact Now

Add to Cart

... canceling earmuffs passive reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in th...

Time : Jan,10,2026
Contact Now

Add to Cart

... of ear canal, ensuring a better sealing, maximum and optimal hearing protection. Performance Earplug dispenser with earplugs, the ...

Time : Dec,09,2024
Contact Now

Add to Cart

... of roads, highways, elevated composite roads and other sources. It is divided into a purely sound-reflecting reflective sound barr...

Time : Dec,09,2024
Contact Now

Add to Cart

... Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep ...

Time : Dec,09,2024
Contact Now

Add to Cart

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for...

Time : Jan,10,2026
Contact Now

Add to Cart

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active Features Immersive sound Premium speaker drivers deli...

Time : Jan,07,2026
Contact Now

Add to Cart

CR Sealed Foam CR0515B Heat-Resistant And Fire Resistant For Civil Engineering Product introduction CR rubber and plastic products are new environment...

Time : Dec,09,2024
Contact Now

Add to Cart

Inquiry Cart 0