China Categories
English
1 - 20 Results for foam for noise reduction from 7035 Products

EPDM E-4088 Black rubber automotive and shock-proof Material / Feature / Application : E-4088 sponge rubber has low hardness...

Time : Oct,03,2025
Contact Now

Add to Cart

3 - 12mm Thickness Fire Retardant Insulation Acoustic Irradiated cross-linked polyethylene (IXPE ) is very fine celled m...

Time : Dec,09,2024
Contact Now

Add to Cart

... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is ...

Time : Sep,21,2025
Contact Now

Add to Cart

...IXPE For Wood Floor Comfort Step And Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and...

Time : Jul,08,2025
Contact Now

Add to Cart

10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction 10mm XPE crosslinked polyethylene foam roll is ideal for noise reduct...

Time : Oct,03,2025
Contact Now

Add to Cart

Recommend Insulation Boards Heat Resistant Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity...

Time : Sep,30,2025
Contact Now

Add to Cart

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

Time : Dec,09,2024
Contact Now

Add to Cart

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

Time : Dec,09,2024
Contact Now

Add to Cart

... Function Reduce Harmful Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

Time : Dec,09,2024
Contact Now

Add to Cart

Aluminum Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functi...

Time : Sep,30,2025
Contact Now

Add to Cart

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose ...

Time : Dec,09,2024
Contact Now

Add to Cart

... Rubber Weather Stripping Epdm Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile ...

Time : Feb,26,2025
Contact Now

Add to Cart

... canceling earmuffs passive reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in th...

Time : Oct,02,2025
Contact Now

Add to Cart

... of ear canal, ensuring a better sealing, maximum and optimal hearing protection. Performance Earplug dispenser with earplugs, the ...

Time : Dec,09,2024
Contact Now

Add to Cart

... of roads, highways, elevated composite roads and other sources. It is divided into a purely sound-reflecting reflective sound barr...

Time : Dec,09,2024
Contact Now

Add to Cart

... Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep ...

Time : Dec,09,2024
Contact Now

Add to Cart

Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for...

Time : Oct,03,2025
Contact Now

Add to Cart

750ml High Temp Pu Sealant Resistant For Insulating Building Seam 750ml Expanding Tube Multi Purpose Construction Use Resistant ...

Time : Dec,09,2024
Contact Now

Add to Cart

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active Features Immersive sound Premium speaker drivers deli...

Time : Jul,25,2025
Contact Now

Add to Cart

Inquiry Cart 0