Business license check OK
1 - 10 Results for noise reduction foam from 8434 Products
Acoustic Foam Self Adhesive Rolls Fire Resistant PET For Noise Reduction
Brand name HY Type Acoustic Foam Usage Living room, read room, media room,ktv, cinema,bar, library Size 30*30cm, 60*60cm Density 2400g/sqm,3000g/sqm Color 40+ color or customized ODM Accept Pattern Customizable supply Ability 8000 SQM day Feature Flame ......
HY New Material Technology Co., Ltd
Verified Supplier
A602, Building 6, Shengshitengfei Huma Zone, Libei, Dali Town, Nanhai District, Foshan City, Guangdong Province
Interior Acoustic Foam Wall Panels Decorative Fiber Glass Noise Reduction Foam Panels
Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding conductive materials such as conductive porcelain clay powder and conductive mica powder, reinforcing ......
Guangzhou Jiansheng Acoustics Decoration Engineering Co., Ltd.
Verified Supplier
No. 19 Anle South Road, Jinpan Village, Zhongluotan Town, Guangzhou, China
Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption
Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-......
Qingdao Huashida Machinery Co., Ltd.
Verified Supplier
69 Jinsheng Second Road Chengyang District, Qingdao, Shandong, China
77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor
Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam......
Starking Shutter Manufacturer Limited
Verified Supplier
Add: No.72, DongChong industrial area, Nansha District, Guangzhou, China
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......
Anhui Uniform Trading Co.Ltd
Verified Supplier
No. 3, Qiaowan Road, Feixi Economic Development Zone, Hefei City, Anhui Pro. (231200), China
Knife Cutting Foam Crusher Machine Low Noise Pu Foam Shredder Machine
... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped with sound insulation and noise reduction device....
Qingdao Xinmeiteng Sponge Manufacture Co.
Verified Supplier
Southeast of No.1180 Jingkou Industrial Park, Jingkou Community, Chengyang District, Qingdao City, Shandong Province
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6....
Earlisten Electronic Co ., Ltd
Verified Supplier
4F Building 2, Feihuangda Shitoushan Industrial ,Shiyan Town ,Bao'an District ,Shenzhen,China
3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction
3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ......
Cyg Tefa Co., Ltd.
Verified Supplier
Building 6-1, Woer Industrial Zone, No.53, Longtian Street, Pingshan District, Shenzhen, China
33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment
...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam......
Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier
No 226, Zhaojia Road, Honglian village, Henlin, Changzhou Economic Development Zone, China
Safety Reusable Silicone Earplugs 31.5*12.5mm with 32dB SNR Noise Reduction and Washable Design
... Silicone Foam Ear Plugs 31.5 X 12.5mm With Nylon PVC Cord Product Overview Safety silicone earplugs with nylon or PVC cord for superior ear protection in various environments. Key Features Perfect Noise Reduction Provides maximum noise reduction (NRR 25dB......
FUTURE TECH LIMITED
Verified Supplier
210, No.328, LongPing East Road, Longgang Street,Longgang District, 518116 Shenzhen city ,China
Submit “noise reduction foam” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
