Business license check OK
1 - 10 Results for noise reduction foam from 7832 Products
Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption
Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-......
Qingdao Huashida Machinery Co., Ltd.
Verified Supplier
69 Jinsheng Second Road Chengyang District, Qingdao, Shandong, China
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6....
Earlisten Electronic Co ., Ltd
Verified Supplier
4F Building 2, Feihuangda Shitoushan Industrial ,Shiyan Town ,Bao'an District ,Shenzhen,China
Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal
... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absorption and sound ......
Qingdao TaiCheng transportation facilities Co.,Ltd.
Verified Supplier
Jinkou Industrial Park, Jimo District, Qingdao, China
FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design
...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam......
FUTURE TECH LIMITED
Verified Supplier
210, No.328, LongPing East Road, Longgang Street,Longgang District, 518116 Shenzhen city ,China
77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor
Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam......
Starking Shutter Manufacturer Limited
Verified Supplier
Add: No.72, DongChong industrial area, Nansha District, Guangzhou, China
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......
Anhui Uniform Trading Co.Ltd
Verified Supplier
No. 3, Qiaowan Road, Feixi Economic Development Zone, Hefei City, Anhui Pro. (231200), China
Interior Acoustic Foam Wall Panels Decorative Fiber Glass Noise Reduction Foam Panels
Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding conductive materials such as conductive porcelain clay powder and conductive mica powder, reinforcing ......
Guangzhou Jiansheng Acoustics Decoration Engineering Co., Ltd.
Verified Supplier
No. 19 Anle South Road, Jinpan Village, Zhongluotan Town, Guangzhou, China
Knife Cutting Foam Crusher Machine Low Noise Pu Foam Shredder Machine
... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped with sound insulation and noise reduction device....
Qingdao Xinmeiteng Sponge Manufacture Co.
Verified Supplier
Southeast of No.1180 Jingkou Industrial Park, Jingkou Community, Chengyang District, Qingdao City, Shandong Province
33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment
...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam......
Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier
No 226, Zhaojia Road, Honglian village, Henlin, Changzhou Economic Development Zone, China
3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction
3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ......
Cyg Tefa Co., Ltd.
Verified Supplier
Building 6-1, Woer Industrial Zone, No.53, Longtian Street, Pingshan District, Shenzhen, China
Submit “noise reduction foam” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
