China Categories
English
1 - 10 Results for noise reduction foam from 7481 Products

Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof

China Split Audiophile Bluetooth Earbuds Noise Reduction Ipx5 Waterproof on sale
... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active noise reduction Features Immersive sound Premium speaker drivers deliver crisp, dynamic audio. Active Noise Reduction Technology and sealed in-ear design limits background noise....
Anhui Arts & Crafts Import & Export Company Ltd.
Verified Supplier
AACC Mansion, 168 Funan Road, Hefei, Anhui, China

Knife Cutting Foam Crusher Machine Low Noise Pu Foam Shredder Machine

China Knife Cutting Foam Crusher Machine Low Noise Pu Foam Shredder Machine on sale
... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped with sound insulation and noise reduction device....
Qingdao Xinmeiteng Sponge Manufacture Co.
Verified Supplier
Southeast of No.1180 Jingkou Industrial Park, Jingkou Community, Chengyang District, Qingdao City, Shandong Province

Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption

China Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption on sale
Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-......
Qingdao Huashida Machinery Co., Ltd.
Verified Supplier
69 Jinsheng Second Road Chengyang District, Qingdao, Shandong, China

Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal

China Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal on sale
... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absorption and sound ......
Qingdao TaiCheng transportation facilities Co.,Ltd.
Verified Supplier
Jinkou Industrial Park, Jimo District, Qingdao, China

FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design

China FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design on sale
...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam......
FUTURE TECH LIMITED
Verified Supplier
210, No.328, LongPing East Road, Longgang Street,Longgang District, 518116 Shenzhen city ,China

77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor

China 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor on sale
Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam......
Starking Shutter Manufacturer Limited
Verified Supplier
Add: No.72, DongChong industrial area, Nansha District, Guangzhou, China

Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam

China Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam on sale
...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ......
SZ PUFENG PACKING MATERIAL LIMITED
Verified Supplier
B/B,Shayi Dongjiang Huanbao Industrial City,Shajing Street,Shenzhen City,China

Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

China Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs on sale
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......
Anhui Uniform Trading Co.Ltd
Verified Supplier
No. 3, Qiaowan Road, Feixi Economic Development Zone, Hefei City, Anhui Pro. (231200), China

Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

China Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones on sale
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6....
Earlisten Electronic Co ., Ltd
Verified Supplier
4F Building 2, Feihuangda Shitoushan Industrial ,Shiyan Town ,Bao'an District ,Shenzhen,China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction

China 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction on sale
3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ......
Cyg Tefa Co., Ltd.
Verified Supplier
Building 6-1, Woer Industrial Zone, No.53, Longtian Street, Pingshan District, Shenzhen, China
Submit “noise reduction foam” inquiry
*From:
Your email address is incorrect!
To:
Anhui Arts & Crafts Import & Export Company Ltd.
*Subject:
Your subject must be between 10-255 characters!
*Message:
Your message must be between 20-3,000 characters!
Yes! I would like your verified suppliers matching service!

This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!

Business license check OK