Business license check OK
1 - 10 Results for foam for noise reduction from 11049 Products
Eco-Friendly Polyethylene Acoustic Foam for Noise Reduction in Vehicles, Trains, and HVAC Systems
... 3510 PO Foam) is a foam product obtained through the processes of blending polyethylene with foaming agents and auxiliaries, followed by extrusion and foaming. Further processing includes laminating with aluminum film and adhesive backing to produce the...
Cyg Tefa Co., Ltd.
Verified Supplier
Building 6-1, Woer Industrial Zone, No.53, Longtian Street, Pingshan District, Shenzhen, China
10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction
10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction 10mm XPE crosslinked polyethylene foam roll is ideal for noise reduction applications. Its dense, crosslinked structure effectively absorbs and dampens sound vibrations, ......
Shenzhen Eco Polyfoam Products Co., Ltd.
Verified Supplier
Jiayu Building, Bao'an district, Shenzhen City, Guangdong Province
High Quality Polyurethane Spray Foam Insulation Thermal Sound Reduction Noise Reduction Wall Polyurethane Spray Foam
Description: BILIN S3 Spray PU Foam is resistant to aging, moisture, and temperature fluctuations, ensuring reliable insulation performance for years. Unlike traditional insulation materials, it won’t sag or degrade over time, maintaining airtight seals......
Zhengzhou Bilin New Materials Manufacturing Co., Ltd.
Verified Supplier
No,26 Dongging road.High-tech zone,Zhengzhou,China
MPV Tailored Chassis Automotive Sound Barrier Insulation Noise Reduction
...vehicle, such as the doors, floor, roof, and firewall. Their strategic placement and combination can effectively minimize noise and improve overall comfort. 2,MPV cars are often used for family outings or group travel, and a quiet interior is essential for...
Guangdong Jirui Acoustic Technology Co., Ltd.
Verified Supplier
Guangdong Foshan Chancheng District Jihua fourth Road creative industry Park
Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......
Anhui Uniform Trading Co.Ltd
Verified Supplier
No. 3, Qiaowan Road, Feixi Economic Development Zone, Hefei City, Anhui Pro. (231200), China
Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6....
Earlisten Electronic Co ., Ltd
Verified Supplier
4F Building 2, Feihuangda Shitoushan Industrial ,Shiyan Town ,Bao'an District ,Shenzhen,China
3mm Super EVA Foam Underlayment Noise Reduction With Blue Aluminum Film
... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is with a 3 mm thick foam layer that provides optimal cushioning and sound absorption, as well as...
Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier
No 226, Zhaojia Road, Honglian village, Henlin, Changzhou Economic Development Zone, China
77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor
Noise Reduction Aluminum Foam Filled Roller Shutters / PU Foam Roller Shutter Product Description Our Noise Reduction Aluminum Foam Filled Roller Shutters provide superior sound insulation combined with enhanced security features, making them ideal for ......
Starking Shutter Manufacturer Limited
Verified Supplier
Add: No.72, DongChong industrial area, Nansha District, Guangzhou, China
EVA Floor Soundproof Film | Noise Reduction Flooring Underlayment Supplier
... comfort, and provide moisture protection for various flooring systems. Manufactured from premium Ethylene Vinyl Acetate (EVA) foam, this flooring underlay offers excellent elasticity, shock absorption, sound insulation, and durability. This product is...
Changzhou Sponge & Rubber Products Co., Ltd
Verified Supplier
No. 4, Building 22, Gufang New Village, Wujin National High-tech Industrial Development Zone,Changzhou City,Jiangsu Province,China
Automatic Control Rubber Foam Insulation Tube/Sheet Production Line for Noise Reduction and Vibration Absorption with NBR/PVC/EPDM Material
...Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption Product Overview Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam......
Qingdao Huashida Machinery Co., Ltd.
Verified Supplier
69 Jinsheng Second Road Chengyang District, Qingdao, Shandong, China
Submit “foam for noise reduction” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
