China Categories
English
1 - 10 Results for foam for noise reduction from 7832 Products

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction

China 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction on sale
3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ......
Cyg Tefa Co., Ltd.
Verified Supplier
Building 6-1, Woer Industrial Zone, No.53, Longtian Street, Pingshan District, Shenzhen, China

Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs

China Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs on sale
... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ......
Anhui Uniform Trading Co.Ltd
Verified Supplier
No. 3, Qiaowan Road, Feixi Economic Development Zone, Hefei City, Anhui Pro. (231200), China

750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam

China 750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam on sale
750ml High Temp Pu Foam Sealant Noise Resistant For Insulating Building Seam 750ml Expanding Tube Foam Multi Purpose Construction Use Noise Resistant Description: I-Like PU Foam Sealant is made of high quality one-component polyurethane material. It has a ......
SHENZHEN I-LIKE FINE CHEMICAL CO., LTD
Verified Supplier
10C, Boxing Building, Qingshuihe 1st Rd., Luohu Dist., Shenzhen, Guangdong, China (Mainland)

Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption

China Industrial Rubber Foam Sheet Pipe Manufacturing Line for Noise Reduction and Vibration Absorption on sale
Product Description Huashida's Rubber Foam Insulation Tube/Sheet Production Line is developed with advanced technology, making it the ideal choice for producing high-quality rubber foam insulation materials (commonly known as "sponge pipes" or "rubber-......
Qingdao Huashida Machinery Co., Ltd.
Verified Supplier
69 Jinsheng Second Road Chengyang District, Qingdao, Shandong, China

Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal

China Professional Noise Reduction Fence Soundproof Material Aluminum Sheet Metal on sale
... reduction of roads, highways, elevated composite roads and other noise sources. It is divided into a purely sound-reflecting reflective sound barrier, and a composite sound barrier combined with sound absorption and sound ......
Qingdao TaiCheng transportation facilities Co.,Ltd.
Verified Supplier
Jinkou Industrial Park, Jimo District, Qingdao, China

FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design

China FT-EM5002 SNR 33dB High Noise Canceling Earmuffs with Passive Noise Reduction Design on sale
...noise canceling earmuffs passive noise reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in the holder casing, to more easy to understand speech and signals. 2. The sealing rings are broad and filled with soft plastic foam......
FUTURE TECH LIMITED
Verified Supplier
210, No.328, LongPing East Road, Longgang Street,Longgang District, 518116 Shenzhen city ,China

3mm Super EVA Foam Underlayment Noise Reduction With Blue Aluminum Film

China 3mm Super EVA Foam Underlayment Noise Reduction With Blue Aluminum Film on sale
... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is with a 3 mm thick foam layer that provides optimal cushioning and sound absorption, as well as...
Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier
No 226, Zhaojia Road, Honglian village, Henlin, Changzhou Economic Development Zone, China

77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor

China 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor on sale
Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam......
Starking Shutter Manufacturer Limited
Verified Supplier
Add: No.72, DongChong industrial area, Nansha District, Guangzhou, China

10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction

China 10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction on sale
10mm Polyethylene Foam Roll Material Xpe Crosslinked Pe Foam For Noice Reduction 10mm XPE crosslinked polyethylene foam roll is ideal for noise reduction applications. Its dense, crosslinked structure effectively absorbs and dampens sound vibrations, ......
Shenzhen Eco Polyfoam Products Co., Ltd.
Verified Supplier
Jiayu Building, Bao'an district, Shenzhen City, Guangdong Province

Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones

China Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones on sale
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6....
Earlisten Electronic Co ., Ltd
Verified Supplier
4F Building 2, Feihuangda Shitoushan Industrial ,Shiyan Town ,Bao'an District ,Shenzhen,China
Submit “foam for noise reduction” inquiry
*From:
Your email address is incorrect!
To:
Cyg Tefa Co., Ltd.
*Subject:
Your subject must be between 10-255 characters!
*Message:
Your message must be between 20-3,000 characters!
Yes! I would like your verified suppliers matching service!

This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!

Business license check OK