Business license check OK
1 - 10 Results for tow truck equipment for sale from 53969 Products
foton auman EST Time-travel edition 560 HP 6X4 Automatic Gear Tractor Truck
Powered by a diesel engine with a horsepower of 560, it has a high torque output and high drivability to cope with heavy duty towing needs. Typically equipped with a multi-speed automatic transmission to provide smooth shifting and ease of operation. 6X4 configuration means that the vehicle has 6 wheels, 4 of which are used for transmission power while the other 2 wheels are used for steering to provide better stability and traction. Higher...
Wuzhou (Shandong) Automobile Co., LTD
Verified Supplier
2nd Floor,Liangshan International Exhibition Center, Quanpu Town, Liangshan County,Jining City,Shandong Province
Anti-Static PCB Handling Equipment The Perfect Solution for Electronics Production
PCB Board Handling Storage Trolley with ESD Protection Introduction Anti-static turnover trolley is also called PCB board turnover cart, transfer cart, storage truck, etc. It's widely used in SMT processing, machinery, automotive, lighting industry, electronics and other production enterprises. It's easy to store, convenient for PCB board turnover, neatly stacked, and easy to manage the PCBs.The turnonver made of anti-static materials and stable...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
DERUI DRUK-6 Underground Wheel Loader OEM LHD Mining Equipment
DERUI DRUK-6 A Low-Maintenance Underground Wheel Loader With Robust Power Train The DERUI DRUK-6 is a mini underground truck with a 6 Ton capacity built to offer the flexible mobility necessary in narrow-vein mining conditions. This mining truck carries high payloads for its weight and is maneuverable and quick on inclines. This 1.5 metre articulated underground four-wheel drive dump truck is easily manoeuvrable in confined areas and well suited...
Shandong Derui Mining Machinery Co., Ltd.
Verified Supplier
No.3701, Zhuangjian Road, Kuiwen District Weifang City, Shandong Province, China.
Economic Electric Pallet Stacker With Mechanical Steering Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Forklift 3 Walkie Stacker With CE Electric Lifter Option Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hand Stacker 2T Load Capacity Electric Pallet Stacker Support After-sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Support After Sales Service Walkie Electric Stacker 1.5 Ton With 4 Meter Triplex Mast
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Support 4ch/5ch/8ch AHD/MDVR/HDD Car Video Recording GPS 4G WiFi Truck Camera System
RICHMOR top sale MDR8114 mobile dvr with USB port for upgrade, mdvr with CMS, bus dvr connect with 4G Product Description Products Advantage: 720P AHD resolution video mobile dvr for vehicle with gps 3g; gps 3g 4g wifi g-sensor mobile dvr with ahd resolution; 4g 3g gps ahd mobile dvr support fuel sensor and RFID etc; Outstanding funtions Parameter Data Sheet Item Parameter OS Linux Language Chinese/English/Others(can be customized) Video...
Shenzhen Richmor Technology Development Co., Ltd.
Verified Supplier
6th Floor, NO.5 Building, LongBi industrial Park, Dafa Road, BanTian, Longgang, Shenzhen,China P.C 518129
Hot sale product 12 inch A3 dtf printer printing machine I3200 XP600 dual heads DTF Printer
Product Description: DTF Printer Machine is a professional DTF printing equipment that provides users with high quality and long-lasting prints. It features an outer packing size of 110cm*84cm*119cm, 97cm*63cm*62cm and a printing width of A3/330MM, making it the perfect choice for large-scale printing applications. It is equipped with two print heads and supports CMYK, White and other inks, ensuring that you get the best color performance. In...
Shaoxing Licai Digital Technology Co., Ltd.
Verified Supplier
1, Building 2, China Textile City Creative Park, Keqiao District
Submit “tow truck equipment for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
