Business license check OK
1 - 10 Results for tow truck company for sale from 51637 Products
foton auman EST Time-travel edition 560 HP 6X4 Automatic Gear Tractor Truck
Powered by a diesel engine with a horsepower of 560, it has a high torque output and high drivability to cope with heavy duty towing needs. Typically equipped with a multi-speed automatic transmission to provide smooth shifting and ease of operation. 6X4 configuration means that the vehicle has 6 wheels, 4 of which are used for transmission power while the other 2 wheels are used for steering to provide better stability and traction. Higher...
Wuzhou (Shandong) Automobile Co., LTD
Verified Supplier
2nd Floor,Liangshan International Exhibition Center, Quanpu Town, Liangshan County,Jining City,Shandong Province
Economic Electric Pallet Stacker With Mechanical Steering Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Forklift 3 Walkie Stacker With CE Electric Lifter Option Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hand Stacker 2T Load Capacity Electric Pallet Stacker Support After-sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Support After Sales Service Walkie Electric Stacker 1.5 Ton With 4 Meter Triplex Mast
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Support 4ch/5ch/8ch AHD/MDVR/HDD Car Video Recording GPS 4G WiFi Truck Camera System
RICHMOR top sale MDR8114 mobile dvr with USB port for upgrade, mdvr with CMS, bus dvr connect with 4G Product Description Products Advantage: 720P AHD resolution video mobile dvr for vehicle with gps 3g; gps 3g 4g wifi g-sensor mobile dvr with ahd resolution; 4g 3g gps ahd mobile dvr support fuel sensor and RFID etc; Outstanding funtions Parameter Data Sheet Item Parameter OS Linux Language Chinese/English/Others(can be customized) Video...
Shenzhen Richmor Technology Development Co., Ltd.
Verified Supplier
6th Floor, NO.5 Building, LongBi industrial Park, Dafa Road, BanTian, Longgang, Shenzhen,China P.C 518129
Factory Direct Sale 99% Purity MOTS-C Drug CAS-1627580-64-63 Mg, 5 Mg, 10 Mg
Name MOTS-c CAS RN 1627580-64-6 Molecular Formula C101H152N28O22S2 Molecular Weight 2174.62 Density 1.44±0.1 g/cm3(Predicted) Storage Condition Store at -20°C Company profile Xingtai Xinzhou Technology Co., Ltd. is a registered enterprise approved by the relevant state departments. Located in Xingtai City, Hebei Province, China. The company spirit of "customer first, integrity first principle, with a number of enterprises to establish long-term...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Construction Works PDC Drill Bits with After-sale Service and API Connection
Product Description: Research and Production Capabilities in the PDC Drill Bit Field In the field of PDC drill bits, we have established ourselves as leaders by demonstrating strong research and production capabilities. PDC drill bits have become a crucial choice in the modern drilling industry, thanks to their efficient and consistent performance. At our company, we use advanced materials and processes to manufacture PDC drill bits that are...
Hejian Ruida Petroleum Material Co., Ltd.
Verified Supplier
Hejian City, Hebei Province, China
Factory Direct Sale Allopregnanolone 99% Purity Alloprogesterone Intermediates
Allopregnanolone, a neurosteroid synthesized from progesterone in the brain, is a highly effective positive allosteric regulator of GABAA receptor. Name Allopregnanolone CAS RN 516-54-1 Molecular Formula C21H34O2 Molecular Weight 318.49 Melting Point 176-178° Specific Rotation D +87.7° (abs alc) Boiling Point 431.2±18.0 °C(Predicted) Density 1.053±0.06 g/cm3(Predicted) Storage Condition Store at RT Structural Formula Company profile Xingtai...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Submit “tow truck company for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
