... Sound Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The is capable to cancel up to 33 dB of noi...
Add to Cart
..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc....
Add to Cart
... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded in various colors including light blue, black, ...
Add to Cart
... use sealing characteristics of silicone material then designed to meet the human structure, a rubber plug can protect the drum by ...
Add to Cart
... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Tunnels OEM/ODM: Acceptable Pierc...
Add to Cart
... Protector Reusable Hearing Protection Reduction Earplugs Earmuff Features: Reduce the can be reduced NRR: 24dB; SNR: 25d...
Add to Cart
HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze....
Add to Cart
... Function Reduce Harmful Type In- Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...
Add to Cart
... Waterproof & Featuring a rotatable silicone wing structure: After inserting into the canal, twist the wings to create a 360° ti...
Add to Cart
Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Ma...
Add to Cart
Pu Foam 【Description】 Sound insulation is made of PU foam, which is easy to put into your to keep away the . Each pair is packed wi...
Add to Cart
Beats Studio 3 Wireless Headphones Blue Dr. Dre Bluetooth Cancelling Pure Adaptive Canceling (Pure ANC) function actively exter...
Add to Cart
1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EY...
Add to Cart
Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description f...
Add to Cart
PRODUCT NAME : canceling cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein...
Add to Cart
... , portability,steadiness and comfortable silica gal hook for . There are four fashion colors for choice,and the control buttons is on the r...
Add to Cart
Product Description: wholesale cool music headphone with in four kinds of colors-black Material ABS, Aluminium or customized material. ...
Add to Cart