China Categories
English
1 - 20 Results for noise blocking ear plugs from 9317 Products

... Sound Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The is capable to cancel up to 33 dB of noi...

Time : Dec,09,2024
Contact Now

Add to Cart

..., it can be an ideal facility used for airplanes, swimming pools, bedrooms, self-study classrooms, factories, construction sites, urban areas, etc....

Time : Dec,09,2024
Contact Now

Add to Cart

... to break, reusable and can be cleaned. 6 Colors: The package contains 30 pairs of corded in various colors including light blue, black, ...

Time : Feb,27,2026
Contact Now

Add to Cart

... use sealing characteristics of silicone material then designed to meet the human structure, a rubber plug can protect the drum by ...

Time : Dec,09,2024
Contact Now

Add to Cart

... effect , handmade piercing jewelry , from 4 gauge to 1" , 13mm high , also can do other color Keywords: Tunnels OEM/ODM: Acceptable Pierc...

Time : Dec,09,2024
Contact Now

Add to Cart

... Protector Reusable Hearing Protection Reduction Earplugs Earmuff Features: Reduce the can be reduced NRR: 24dB; SNR: 25d...

Time : Dec,09,2024
Contact Now

Add to Cart

HQ2EDGKM-5.0/5.08 mm pitch screw fixed ear plug-in type brass terminal block Pitch 5.0/5.08mm Screw M2.5.Steel.Zinc plated Wire guard Phosphor bronze....

Time : Jun,19,2026
Contact Now

Add to Cart

... Function Reduce Harmful Type In- Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

Time : Dec,09,2024
Contact Now

Add to Cart

... Waterproof & Featuring a rotatable silicone wing structure: After inserting into the canal, twist the wings to create a 360° ti...

Time : Jun,19,2026
Contact Now

Add to Cart

Ethnic Black Spiral Earrings Ear Plugs Acrylic Piercing Drop Earring Punk Twister Earrings for Women Product Description Product name Stud earrings Ma...

Time : Dec,09,2024
Contact Now

Add to Cart

Pu Foam 【Description】 Sound insulation is made of PU foam, which is easy to put into your to keep away the . Each pair is packed wi...

Time : Dec,09,2024
Contact Now

Add to Cart

Beats Studio 3 Wireless Headphones Blue Dr. Dre Bluetooth Cancelling Pure Adaptive Canceling (Pure ANC) function actively exter...

Time : Dec,09,2024
Contact Now

Add to Cart

1, Product Name: Sleep Eye Mask Cover with Ear Plugs, Light Blocking Memory Foam Eye Mask with Adjustable Strap for Sleeping/Shift Work ★ ELIMINATE EY...

Time : Dec,09,2024
Contact Now

Add to Cart

Specifications -Foam earplug or silicone earplug -Metal tube with key ring,ball chain or hook. -Colour depends on need -Logo print is ok Description f...

Time : Dec,09,2024
Contact Now

Add to Cart

PRODUCT NAME : canceling cushion protein PU leather plus memory foam for the gaming headphone Item number :HR260519 Materials : high protein...

Time : May,23,2026
Contact Now

Add to Cart

... , portability,steadiness and comfortable silica gal hook for . There are four fashion colors for choice,and the control buttons is on the r...

Time : Dec,09,2024
Contact Now

Add to Cart

Product Description: wholesale cool music headphone with in four kinds of colors-black Material ABS, Aluminium or customized material. ...

Time : Dec,09,2024
Contact Now

Add to Cart

Inquiry Cart 0