Business license check OK
1 - 10 Results for tungsten powder for sale from 7282 Products
Purity 99% Angiotensin II 68521-88-0 Angiotensin 2 Raw Powder Hot Sale
Pharmaceutical Chemical Peptide Angiotensin II Human Acetate Salt CAS 68521-88-0 Angiotensin II is an octapeptide that is a potent but labile vasoconstrictor. It is produced from angiotensin I after the removal of two amino acids at the C-terminal by ANGIOTENSIN CONVERTING ENZYME. The amino acid in position 5 varies in different species. To block VASOCONSTRICTION and HYPERTENSION effect of angiotensin II, patients are often treated with ACE...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
for Sale Pharmaceutical Raw Material 99% Mitomycin C Powder CAS 51333-22-3 Mitomycin
for Sale Pharmaceutical Raw Material 99% Mitomycin C Powder CAS 51333-22-3 Mitomycin Mitomycin C is extracted from Streptomyces bacteria (bacteria) out of a broad-spectrum antitumor antibiotics, genetic toxicity and tumor resistance, is widely recognized inhibitors of DNA damage, have anti-cancer effect to many kinds of cancer, after activation, can play a role of DNA alkylating agent, action principle is to make the cell's DNA depolymerization,...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
CAS 10124-56-8 Industrial Fine Powdered SHMP Sodium Hexametaphosphate
CD Chem Direct Sale Of Industrial Grade Fine Powdered Sodium Hexametaphosphate Shmp CAS 10124-56-8 Basic Information Model Number: HMHT0235 Other Names: Calgon Molecular Formula: Na6O18P6 Molecular Weight: 611.77 CAS NO.: 10124-56-8 EINECS NO.: 233-343-1 Product Param Item Enterprise Standard Density 2.181g/cm3 Melting point 616°C Refractive index 1.482 Appearance white powder crystal Solubility easily soluble in water, insoluble in organic...
Wuxi High Mountain Hi-tech Development Co.,Ltd
Verified Supplier
No.1406, Building 3, Calxon Fortune Center, Financial 3rd Street, Jingkai District, Wuxi, P. R. of China
Factory Direct Sales Of Chemical Raw Materials 2-Bromo-1-Phenyl-Pentan-1-One CAS-49851-31-2 99% Purity
Factory Direct Sales Of Chemical Raw Materials 2-Bromo-1-Phenyl-Pentan-1-One CAS-49851-31-2 99% Purity 2-bromo-1-phenyl-1-pentanone is a white crystalline powder, a derivative of valerone. It can be used as pharmaceutical intermediates. Name 2-Bromo-1-phenyl-pentan-1-one CAS RN 49851-31-2 Molecular Formula C11H13BrO Molecular Weight 241.12 EINECS 100-201-4 Boiling Point 94-96 °C(Press: 0.25 Torr) Density 1.310±0.06 g/cm3(Predicted) structural...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Popular Sale White Power Semaglutide Cas 910463-68-2 For Weight Loss 5mg 10mg/Vial With High Purity
Product Detail Boiling point 585.6±45.0°C(Predicted) Density 1.21±0.1g/cm3(Predicted) Solubility DMF:25mg/ml DMF:PBS(pH7.2Chemicalbook)(1:1):0.5mg/ml DMSO:2 0mg/mlEthanol:10mg/ml powder Acidity coefficient (pKa)9.85±0.19 (Predicted) Color Yellow Delivery Time: within 3 days after we get your payment Package: aluminum foil bag or as required Storage: Store in a cool and dry place and keep away from direct strong light Shipment: EMS, DHL, UPS,...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Bulk Sale Ketone Ester / Beta-Hydroxybutyrate / R-BHB CAS 1208313-97-6
Ketone Ester white powder CAS 1208313-97-6 with factory price and door to door services What is Ketone Ester? It's the world's first ketone ester and it is used by a lot of the world's leading athletes. Ketone Ester is basically raw beta-hydroxybutyrate (BHB) ketone, a compound that is produced in the liver during periods of extremely low carbohydrate intake. When the body is pushed to the limit, it produces fuel for its cells in the form of...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Factory Direct Sale YK11 CAS-431579-34-9 Increase Muscle Growth 99% Purity
Myostatin production in muscles can be inhibited by attaching receptors. It may induce muscles to produce more folliclestatin, which in turn limits myostatin levels, allowing for increased muscle growth beyond genetic ability. Name YK11 CAS RN 431579-34-9 Molecular Formula C25H34O6 Molecular Weight 430.53386 EINECS 431-340-9 Form Powder structural formula Company profile Xingtai Xinzhou Technology Co., Ltd. is a registered enterprise approved by...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Tungsten Powder Tungsten Concentrate Wolframite Tungsten Powder 99.98%
Tungsten Powder Tungsten Concentrate Wolframite Tungsten Powder 99.98% Tungsten powder is a fine, grayish-black powder made of tungsten metal particles. It is typically produced through a process called reduction, in which tungsten oxide or other tungsten compounds are reduced with hydrogen gas or other reducing agents to produce pure tungsten powder. Tungsten powder has several characteristics that make it useful in various industrial and...
Suzhou Haichuan Rare Metal Products Co., Ltd.
Verified Supplier
NO.583, Sunwu Road, Xukou Town, Wuzhong District, Suzhou City China.
High Purity 99.95% Pure Spray W Metal Crystal Tungsten Powder For Sale
High Purity 99.95% Pure Spray W Metal Crystal Tungsten Powder For Sale Properties: Tungsten powder is powder shape tungsten metal, and it is is the raw material for the preparation of tungsten processing materials, tungsten alloys and tungsten products. Storage Conditions: Tungsten powder should be stored in dry, cool and sealing of the environment, can not be exposure to air, in addition should avoid the heavy pressure, according to ordinary...
Eternal Bliss Alloy Casting & Forging Co.,LTD.
1099 Xinhua Road,214104, Xishan District, Wuxi, Jiangsu,China
Submit “tungsten powder for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
