Business license check OK
1 - 10 Results for tractor truck for sale by owner from 21137 Products
FAW used Heavy Duty 6x4 550hp J6P Tractor Truck
This FAW Used Heavy Duty 6x4 550 HP J6P Tractor is a reliable, high-performance transportation solution for long-haul, heavy-duty freight and other heavy-duty transportation tasks. The powerful horsepower is equipped with a 550 hp engine, which provides strong power and excellent carrying capacity, and can easily handle long-distance and heavy-duty transportation tasks. Adopting 6x4 drive system ensures good traction and stability, adapting to a...
Wuzhou (Shandong) Automobile Co., LTD
Verified Supplier
2nd Floor,Liangshan International Exhibition Center, Quanpu Town, Liangshan County,Jining City,Shandong Province
foton auman EST Time-travel edition 560 HP 6X4 Automatic Gear Tractor Truck
Powered by a diesel engine with a horsepower of 560, it has a high torque output and high drivability to cope with heavy duty towing needs. Typically equipped with a multi-speed automatic transmission to provide smooth shifting and ease of operation. 6X4 configuration means that the vehicle has 6 wheels, 4 of which are used for transmission power while the other 2 wheels are used for steering to provide better stability and traction. Higher...
Wuzhou (Shandong) Automobile Co., LTD
Verified Supplier
2nd Floor,Liangshan International Exhibition Center, Quanpu Town, Liangshan County,Jining City,Shandong Province
Richmor Classical In-Vehicle CCTV 4G Mobile DVR The Ultimate Choice for Truck Owners
Richmor sd-card dvr 4 channel mobile dvr 4ch mdvr mini size car black box PRODUCT DESCRIPTION Resolution 4CH 1080P/720P AHD Full real-time recording Moduel G-Sensor built in Storage Support 2X SD cards storage, up to 128GB for each Alarm I/O 4CH Alarm input,1CH Alarm output ACC Delay 10 seconds delay pow-off for data protection Voltage 8V-36V Wide range voltage power supply *Support 3G/4G, WIFI, GPS/GLONASS, etc. (Optional) Detailed specification...
Shenzhen Richmor Technology Development Co., Ltd.
Verified Supplier
6th Floor, NO.5 Building, LongBi industrial Park, Dafa Road, BanTian, Longgang, Shenzhen,China P.C 518129
Economic Electric Pallet Stacker With Mechanical Steering Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Forklift 3 Walkie Stacker With CE Electric Lifter Option Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hand Stacker 2T Load Capacity Electric Pallet Stacker Support After-sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Support After Sales Service Walkie Electric Stacker 1.5 Ton With 4 Meter Triplex Mast
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Support 4ch/5ch/8ch AHD/MDVR/HDD Car Video Recording GPS 4G WiFi Truck Camera System
RICHMOR top sale MDR8114 mobile dvr with USB port for upgrade, mdvr with CMS, bus dvr connect with 4G Product Description Products Advantage: 720P AHD resolution video mobile dvr for vehicle with gps 3g; gps 3g 4g wifi g-sensor mobile dvr with ahd resolution; 4g 3g gps ahd mobile dvr support fuel sensor and RFID etc; Outstanding funtions Parameter Data Sheet Item Parameter OS Linux Language Chinese/English/Others(can be customized) Video...
Shenzhen Richmor Technology Development Co., Ltd.
Verified Supplier
6th Floor, NO.5 Building, LongBi industrial Park, Dafa Road, BanTian, Longgang, Shenzhen,China P.C 518129
JP 2kw 24v Diesel Parking heater Webasto 12v Diesel Truck Bus Diesel Heater 12v Parking Heater For Camper RV
Product Description Product performance description A Diesel AIR Parking Heater is an electro-mechanical device that uses air to warm/heat the interior and engine of a motor vehicle to a suitable temperature so that the vehicle’s owner could enjoy a cozy and comfortable atmosphere pleasantly. Details Images Product Usage The working principle of air diesel parking heaters is based on the following key principles: Heater system draws in fuel and...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Submit “tractor truck for sale by owner” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
Hot Products :
