Business license check OK
1 - 10 Results for macbook air for sale from 13841 Products
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
661-16806 661-15389 661-16807 Macbook LCD Screen Replacement For MacBook Air Retina 13 A2337 M1
661-16806 661-15389 661-16807 Full LCD Display Assembly For MacBook Air Retina 13 A2337 M1 2020 Laptop LCD Replacement Replacement Descriptions: Compatible For :MacBook Air Retina 13 A2337 M1 2020 LCD Replacement MPN 661-16806 661-15389 661-16807 MacBook Air Retina 13 A2337 M1 2020 13" LCD whole top case Assembly Frequent Asked Question: FAQ: 1. What's the quality level? A:Original and new, High quality with Grade A+ 2. How to find the correspond...
Shenzhen Shengchuang Jingcai Technology Co., Ltd.
Verified Supplier
A-3F ManHa Building,ZhenXin Rd. FuTian Dist. ShenZhen, China
661-7468 661-02345 Macbook LCD Screen Replacement 11.6" For Apple MacBook Air 11" A1465
661-7468 661-02345 Complete Display Assembly 11.6" Apple MacBook Air 11" A1465 Laptop LCD Replacement Replacement Descriptions: Compatible For :Apple MacBook Air 11" A1465 LCD Replacement MPN 661-7468 661-02345 Apple MacBook Air 11" A1465 11" LCD whole top case Assembly Frequent Asked Question: FAQ: 1. What's the quality level? A:Original and new, High quality with Grade A+ 2. How to find the corresponding product model? A:You can check the label...
Shenzhen Shengchuang Jingcai Technology Co., Ltd.
Verified Supplier
A-3F ManHa Building,ZhenXin Rd. FuTian Dist. ShenZhen, China
661-15389 Apple LCD Display Space Grey For MacBook Air 13" 2020 Scissors A2179
661-15389 Apple LCD Display Space Grey for MacBook Air 13" 2020 Scissors A2179 Laptop LCD Replacement Replacement Descriptions: Compatible For :MacBook Air 13" 2020 Scissors A2179 LCD Replacement MPN 661-15389 MacBook Air 13" 2020 Scissors A2179 13" LCD whole top case Assembly Frequent Asked Question: FAQ: 1. What's the quality level? A:Original and new, High quality with Grade A+ 2. How to find the corresponding product model? A:You can check...
Shenzhen Shengchuang Jingcai Technology Co., Ltd.
Verified Supplier
A-3F ManHa Building,ZhenXin Rd. FuTian Dist. ShenZhen, China
Webasto Diesel 2kw 5kw Heater 12v 24v Truck Cab Parking eberspacher Air Heater
Detailed Images Our Company JP China Trade Int'l Ltd. involves the whole china of supply, from manufacturing to sales and after-sales services. Our heaters are sold to such countries as Russia, Ukraine, Sweden, Norway, German, Canada, America, New Zealand and others. And we have exclusive agency in UK and Australia. Parking heaters can be used for cars, Bus, Motorhomes, Trucks, Campers, Boats and yachts, etc. There are mainly two types of...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
JP 2.2KW 12V diesel air parking heater gas heater for car truck boat motorhome caravan
Product Description Heater Power 2.2KW Fuel Type Gas Rated Voltage 12V Fuel Consumption 0.12~0.24 Working Temperature -40℃~+20℃ Mobile Phone Control (Optional) No Limitation Remote Control (Optional) Without Obstacles≤800m Detailed Images Our Company JP China Trade Int'l Ltd. involves the whole china of supply, from manufacturing to sales and after-sales services. Our heaters are sold to such countries as Russia, Ukraine, Sweden, Norway, German,...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Webasto Diesel 2.2kw Heater 12v 24v Truck Cab Parking eberspacher Air Heater
Product Description Heater Power 2.2KW Fuel Type Diesel Heater Rated Voltage 12V/24V Fuel Consumption 0.12~0.24 Working Temperature -40℃~+20℃ Mobile Phone Control (Optional) No Limitation Remote Control (Optional) Without Obstacles≤800m Detailed Images Our Company JP China Trade Int'l Ltd. involves the whole china of supply, from manufacturing to sales and after-sales services. Our heaters are sold to such countries as Russia, Ukraine, Sweden,...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Air Condition 13.6 Kg R134A Refrigerant Gas 99.99% Purity
Air Condition 13.6 Kg R134A Refrigerant Gas for Sale Product Description R134a Index Unit R134a Chemical formula CH2FCF3 Molecular weight g/mol 102.0 Boiling point 101.3kpa (°C) °C -26.2 Freezing point 101.3kpa (°C) °C -96.6 Critical temperature °C 101.1 Critical pressure KPa 4066.6 Saturated liquid density (25°C) Kg/m3 1188.1 Specific heat (25°Cliquid) KJ/kg·k 1.42 Critical density g/cm3 0.512 Vaporization heat at boiling point KJ/kg 215.0 Water...
Chengdu Henbin Refrigeration Co., Ltd
Air Conditioning R407c Refrigerant 99.99% Purity Freon 407c
Mix Air Conditioning Refrigerant Gas R404A R407c Refrigerant for Sale Product Description Physical properties Model NO. R407c Chemical formula CH2F2/CHF2CF3/CF3CH2F Molecular weight 86.2 Boiling point 101.3 KPa(ºC) -43.8 Freezing point 101.3 KPa(ºC) - Density 30ºC( kg/m3) 1129.30 Critical temperature(ºC) 86.74 Critical pressure(MPa) 4.62 ODP 0 GWP 1700 Quality Index Purity ≥99.8% Water content ≤0.001% Acidity ≤0.0001% Evaporation residue ≤0.01%...
Chengdu Henbin Refrigeration Co., Ltd
JP Combi 6KW 12V Diesel Air And Water motorhome RV Camper Heater Similar To Truma
Packing & Delivery Carton Company Profile 00:00 03:00 JP China Trade Int'l Co., Ltd. was founded in Beijing and is a Russian-Chinese joint venture company specialized in import and export business. Using our marketing advantages and strong sales and purchasing ability, our company has established reliable business relationships with clients. We have professional staff members, who have deep understanding of Chinese, European and American markets...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Submit “macbook air for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
