Business license check OK
1 - 10 Results for hydraulic truck crane for sale from 44363 Products
Heavy Duty Automatic Forklift Throttle Power Steering With Hydraulic Brake 10 Mph Top Speed
Product Description: The Forklift Throttle designed for heavy-duty forklift trucks is an essential component for any industrial operation requiring reliable and efficient material handling equipment. This state-of-the-art throttle is engineered to cater to demanding work environments where forklifts are the backbone of productivity, ensuring that your operations run smoothly and safely. The integration of the Forklift Speed Limiter within the...
Hefei Liftpart Machinery Technology Co., Ltd.
Verified Supplier
369 Logistics Park, Luming Shan Road, Yaohai Industry Area, Yaohai District, Hefei city, Anhui province, China.
3000mm Lifting Height Electric Stacker with 2T Load Capacity and Hydraulic Lift Motor
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Single Face Style Hand Pallet Stacker With Hydraulic Lift Motor Electric Power Upgrade
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hydraulic Lift Motor Small Electric Pallet Stacker For Versatile Material Handling
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Upt-97/1800 Mining Crushing Underground Utility Vehicle Truck Custom
Speeding (km/h) I Gear 4.7 II Gear 8.2 III Gear 15.3 IV Gear 17.2 Working Condition Mode Front double legs, oil cylinder stabilizes the vehicle Hydraulic oil tank (L) 165 Oil tank (L) 176 Tyre 12.00-24 Motor QSB4.5-C130 97kW(National level 3 ) DONDFENG CUMMINS Torque converter YJ315X SHANTUI POWER Gearbox YD130 HANGZHOU GEAR Driving Axle CY-2 F/R XUZHOU QINGFENG Hammer Head 1600 YANTAI AIDI...
Shandong Derui Mining Machinery Co., Ltd.
Verified Supplier
No.3701, Zhuangjian Road, Kuiwen District Weifang City, Shandong Province, China.
Economic Electric Pallet Stacker With Mechanical Steering Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Forklift 3 Walkie Stacker With CE Electric Lifter Option Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hand Stacker 2T Load Capacity Electric Pallet Stacker Support After-sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Support After Sales Service Walkie Electric Stacker 1.5 Ton With 4 Meter Triplex Mast
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Submit “hydraulic truck crane for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
