Business license check OK
1 - 10 Results for hot air cloth dryer from 40619 Products
PCB Handling Equipment HS-800 BGA Rework Station with Hot Air Mounting Head Integration
PCB Handling Equipment HS-800 BGA Rework Station with Hot Air Mounting Head Integration Specification BGA Rework Station Model:HS-800 Heater power Top heater 1200W(Max), bottom heater 1200W(Max) Bottom Pre-Heating IR 5000w Temperature control K-type thermocouple,close loop control Locating way Outer or location hole Overall dimension L970mm*W700mm*H830mm PCB size W650*D610mm BGA size Max 80mm*80mm Min 1mm*1mm Applicable PCB thickness 0.3 - 5mm...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
High Speed Dtf Pro Printer 60cm Clothes Dtf Inkjet Printer Pet Film Industrial Dtf Printer A1 With Shaker And Dryer
5 Head i3200 digital dtf printer 60cm pet film t shirt clothes dtf printing machine shake powder dtf printer Product Description: The A3 DTF Printer Machine is an advanced printing equipment that offers superior printing accuracy and efficiency. It boasts a 360*2400DPI, 360*3600DPI, and 720*2400DPI printing accuracy, and its gross weight is 61.5KG for the printer and 131KG for the powder dryer. Its printer packing size is 97cm*63cm*62cm, and its...
Shaoxing Licai Digital Technology Co., Ltd.
Verified Supplier
1, Building 2, China Textile City Creative Park, Keqiao District
Self-Detection System Alarm Automatically With Air Pressure Supply Hot Sealing External Vacuum Packing Machine
Self-Detection System Alarm Automatically With Air Pressure Supply Hot Sealing External Vacuum Packing Machine Introduction This external vacuum packing machine using upper and down hot sealing packing method, the whole machine is made of painted shell, also can be customized using stainless steel. The platform is adjustable to choose the right height you need, slience wheel for the machine movement. Specification Model VS-600WB Packing capacity...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Air Pressure Supply Hot Sealing Vacuum Packing Machine Floor Standing Upper And Down
Floor Standing Upper and Down Hot Sealing Vacuum Packing Machine Introduction This external vacuum packing machine using upper and down hot sealing packing method, the whole machine is made of painted shell, also can be customized using stainless steel. The platform is adjustable to choose the right height you need, slience wheel for the machine movement. Features 1, Compare with the standard external packing machine, this unit machine using hot...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
High Gloss 3 Inch 17 Mic Double Sided Hot Laminating Film Corona BOPP Protective
High Gloss Good Light Transmittance 3 Inch 17 Mic Double Sided Hot Laminating Film Corona BOPP Protective The Bopp thermal laminating film is especially good at laminating on the paper, improving the texture and stiffness of printedmatter, to achieve increasing the printed matter grades and water-proof function, keep the air from the prints surface, to avoidfaded and become long-tern preservation, which is ideal film for inkjet printing, laser...
NEWFLM(GUANGDONG)TECHNOLOGY CO.,LTD
Verified Supplier
Tengjin Technology Park,No.7,Huaguoshan Road,XinAn community,ChangAn,Dongguan,GuangDong,China.
Hot Mono Di Potassium Salts Of Fungicide Phosphorous Acid Powder
Hot Mono- And Di-potassium Salts Of Fungicide Phosphorous Acid With Wholesale Price Basic Information Colorless crystals. The relative density is 1.651 (21.2°C). Melting point 73,6 ℃. The boiling point of 200 ° C (decomposition). Soluble in water and alcohol. It is slowly oxidized into orthophosphoric acid in the air, and decomposed into orthophosphoric acid and phosphine (highly toxic) when heated to 180 °C. Phosphorous acid is a dibasic acid,...
Wuxi High Mountain Hi-tech Development Co.,Ltd
Verified Supplier
No.1406, Building 3, Calxon Fortune Center, Financial 3rd Street, Jingkai District, Wuxi, P. R. of China
5-10mm Sealing Width External Vacuum Packing Machine With Air Pressure Supply
5-10mm Sealing Width External Vacuum Packing Machine With Air Pressure Supply Introduction This external vacuum packing machine using upper and down hot sealing packing method, the whole machine is made of painted shell, also can be customized using stainless steel. The platform is adjustable to choose the right height you need, slience wheel for the machine movement. Features 1, Compare with the standard external packing machine, this unit...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Hot Sale Gorgeous blue silk cloth drape valance curtains with ivory tassel
#detail_decorate_root .magic-0{border-bottom-style:solid;border-bottom-color:#53647a;font-family:Roboto;font-size:24px;color:#53647a;border-bottom-width:2px;padding-top:8px;padding-bottom:4px}#detail_decorate_root .magic-1{width:750px}#detail_decorate_root .magic-2{overflow:hidden;width:750px;height:589px;margin-top:0;margin-bottom:0;margin-left:0;margin-right:0}#detail_decorate_root .magic-3{margin-top:0;margin-left:0;width:750px;height:589px}...
PUJIANG SAIXIN DECOR LLC
Verified Supplier
208 HengSheng Road,Pujiang ,Zhejiang ,China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
JP Combi air and water diesel heater CE Zertifiziertung Similar to Truma D6 E heaters for motorhome camper caravans
The heater is a hot water and warm air integrated machine, which can provide domestic hot water while heating the occupants. This heater allows use during driving.This heater also has the function of using local electricity heating....
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Submit “hot air cloth dryer” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
