Business license check OK
1 - 10 Results for vacuum tanker truck for sale from 20014 Products
3 Axle 42000 45000 Liters Aluminum Carbon Steel Oil Tanker Fuel Tank Semi Trailer Oil Tank Truck Trailer
This aluminum tank semi-trailer is a special vehicle for transporting various liquid petroleum products. It is made of high-strength aluminum alloy material, featuring lightweight, corrosion resistance and high strength. The maximum volume of this tank semi-trailer is 45,000 liters, which can meet the demand for large-capacity transportation. It adopts a three-axle design to provide good stability and maneuverability. Each axle is fitted with...
Wuzhou (Shandong) Automobile Co., LTD
Verified Supplier
2nd Floor,Liangshan International Exhibition Center, Quanpu Town, Liangshan County,Jining City,Shandong Province
Economic Electric Pallet Stacker With Mechanical Steering Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Forklift 3 Walkie Stacker With CE Electric Lifter Option Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hand Stacker 2T Load Capacity Electric Pallet Stacker Support After-sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Support After Sales Service Walkie Electric Stacker 1.5 Ton With 4 Meter Triplex Mast
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Support 4ch/5ch/8ch AHD/MDVR/HDD Car Video Recording GPS 4G WiFi Truck Camera System
RICHMOR top sale MDR8114 mobile dvr with USB port for upgrade, mdvr with CMS, bus dvr connect with 4G Product Description Products Advantage: 720P AHD resolution video mobile dvr for vehicle with gps 3g; gps 3g 4g wifi g-sensor mobile dvr with ahd resolution; 4g 3g gps ahd mobile dvr support fuel sensor and RFID etc; Outstanding funtions Parameter Data Sheet Item Parameter OS Linux Language Chinese/English/Others(can be customized) Video...
Shenzhen Richmor Technology Development Co., Ltd.
Verified Supplier
6th Floor, NO.5 Building, LongBi industrial Park, Dafa Road, BanTian, Longgang, Shenzhen,China P.C 518129
Webasto Diesel 2kw 5kw Heater 12v 24v Truck Cab Parking eberspacher Air Heater
Detailed Images Our Company JP China Trade Int'l Ltd. involves the whole china of supply, from manufacturing to sales and after-sales services. Our heaters are sold to such countries as Russia, Ukraine, Sweden, Norway, German, Canada, America, New Zealand and others. And we have exclusive agency in UK and Australia. Parking heaters can be used for cars, Bus, Motorhomes, Trucks, Campers, Boats and yachts, etc. There are mainly two types of...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
JP 2.2KW 12V Parking Heater Diesel for truck cars similar to Webasto
Product Description Heater Power 2.2KW Fuel Type Diesel Heater Rated Voltage 12V/24V Fuel Consumption 0.12~0.24 Working Temperature -40℃~+20℃ Mobile Phone Control (Optional) No Limitation Remote Control (Optional) Without Obstacles≤800m Detailed Images Our Company JP China Trade Int'l Ltd. involves the whole china of supply, from manufacturing to sales and after-sales services. Our heaters are sold to such countries as Russia, Ukraine, Sweden,...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
JP 2.2KW 12V diesel air parking heater gas heater for car truck boat motorhome caravan
Product Description Heater Power 2.2KW Fuel Type Gas Rated Voltage 12V Fuel Consumption 0.12~0.24 Working Temperature -40℃~+20℃ Mobile Phone Control (Optional) No Limitation Remote Control (Optional) Without Obstacles≤800m Detailed Images Our Company JP China Trade Int'l Ltd. involves the whole china of supply, from manufacturing to sales and after-sales services. Our heaters are sold to such countries as Russia, Ukraine, Sweden, Norway, German,...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Submit “vacuum tanker truck for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
