Business license check OK
1 - 10 Results for used renault express from 9387 Products
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
CAS 52232-67-4 Cosmetic Peptide Teriparatide Acetate 98% Safe Delivery
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99%Min Assay Teriparatide Acetate Cosmetic Peptide CAS 52232-67-4 With Safe Custom
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3 19356-17-3
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Best Price Calcifediol 25-Hydroxyvitamin D3 CAS 19356-17-3 With Safe Delivery
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Anti-Aging Health Care Products Beta Nicotinamide Mononucleotide Cas 1094-61-7
Raw Materials For Anti-Aging Health Care Products Β-Nicotinamide Mononucleotide Cas-1094-61-7 Studies have shown that β-NMN can also regulate the secretion of insulin and affect the expression level of mRNA. It's also used in anti-aging research,β-NMN has a wide application prospect in the field of medical treatment. β-Nicotinamide Mononucleotide is converted into a substance called "nicotinamide adenine dinucleotide (NAD)" which is essential...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Cosmetics β-Nicotinamide Mononucleotide Health Care Products Cas 1094-61-7
Raw Material Of Cosmetics Β-Nicotinamide Mononucleotide Health Care Products Cas 1094-61-7 Studies have shown that β-NMN can also regulate the secretion of insulin and affect the expression level of mRNA. It's also used in anti-aging research,β-NMN has a wide application prospect in the field of medical treatment. β-Nicotinamide Mononucleotide is converted into a substance called "nicotinamide adenine dinucleotide (NAD)" which is essential for...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Raw Materials Of Health Care Products Beta-Nicotinamide Mononucleotide Cas 1094-61-7
Raw Materials Of Health Care Products BETA-NICOTINAMIDE MONONUCLEOTIDE Cas 1094-61-7 Studies have shown that β-NMN can also regulate the secretion of insulin and affect the expression level of mRNA. It's also used in anti-aging research,β-NMN has a wide application prospect in the field of medical treatment. BETA-NICOTINAMIDE MONONUCLEOTIDE is converted into a substance called "nicotinamide adenine dinucleotide (NAD)" which is essential for...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Auto Brake Caliper 44001-5452R 44001-1818R 7701209868 440015452R 440011818R 344645 for RENAULT KANGOO
BIT Brake Caliper 4154201583 A4154200183 44001-1818R 44001-5452R 7701209868 344645 For RENAULT KANGOO Express Fitment RENAULT KANGOO / GRAND KANGOO (KW0/1_) (2008/02 - /) RENAULT KANGOO Express (FW0/1_) (2008/02 - /) RENAULT KANGOO BE BOP (KW0/1_) (2009/02 - /) OEM Number 4154201583 A4154200183 44001-1818R 44001-5452R 7701209868 What You Can Get from Our Factory BIT’s main business is the development and manufacturing of automotive brake-related...
Wenzhou Bit Automobile Parts Co., Ltd.
Verified Supplier
Pingyang, Wenzhou City, Zhejiang Province, China
IWP099 Nozzle Fuel Injector For Peugeot 206 1.4 16V KFU 1.4 8V KFW Renault Clio
IWP099 Nozzle Fuel Injector For Peugeot 206 1.4 16V KFU 1.4 8V KFW Renault Clio Kangoo Description Fuel Injector For F ord Peugeot 206 1.4 16V KFU 1.4 8V KFW Renault Clio Kangoo Part number : IPM099 280158168 8200025248 805001388502 8200051963 8200025248 Used on: Peugeot 206 1.0 16V Renault Clio 1.0 16V Renault Kangoo 1.0 16V Kangoo Express 2001-2007 Thalia I 2002-2006 Twingo 1993-1996 Specification Item name IWP099 Fuel Injector For F ord...
Xi'An YingBao Auto Parts Co.,Ltd
Verified Supplier
Bei Lin Qu Zhu Que Da Jie Bei Duan Xi An Gong Guan 4-283 Xi'An City ShaanXi Province China，Post Code: 710068
Submit “used renault express” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
