Business license check OK
1 - 10 Results for truck mounted drill rig for sale from 43449 Products
Other Panasonic Chip Mounting Machine Parts on Sale
SMT Machine Panasonic CM602 CM402 Flat Conveyor Belt KXF0DKFAA00 8.5mm Introduction This conveyor belt used for the model Panasonic pick and place machine CM402 and CM602, its made of rubber, thickness 85mm,its a original new part for replacements. Specification Product name Panasonic Chip mounter flat belt Part number KXF0DKFAA00 Machine model CM602,CM402 Thickness 8.5mm Materials Rubber Manufacturer Panasonic corporation Condition Original new,...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Construction Works PDC Drill Bits with After-sale Service and API Connection
Product Description: Research and Production Capabilities in the PDC Drill Bit Field In the field of PDC drill bits, we have established ourselves as leaders by demonstrating strong research and production capabilities. PDC drill bits have become a crucial choice in the modern drilling industry, thanks to their efficient and consistent performance. At our company, we use advanced materials and processes to manufacture PDC drill bits that are...
Hejian Ruida Petroleum Material Co., Ltd.
Verified Supplier
Hejian City, Hebei Province, China
DRWJ-4 Diesel LHD Custom Mining Underground Rock Drilling Machine
Maximize Efficiency With The DRWJ-4 Diesel LHD For Load-And-Carry In Mine Environments The DRWJ-4 is a robust 10 metric tonne LHD. The rugged powertrain and high-lifting design simplifies underground truck loading. It is a diesel-powered heavy-duty machine intended for the most demanding mine environments. The DRWJ-4 is designed for small- to medium-size openings for load-and-carry applications. Service points are easily accessible, making daily...
Shandong Derui Mining Machinery Co., Ltd.
Verified Supplier
No.3701, Zhuangjian Road, Kuiwen District Weifang City, Shandong Province, China.
Economic Electric Pallet Stacker With Mechanical Steering Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Forklift 3 Walkie Stacker With CE Electric Lifter Option Support After Sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hand Stacker 2T Load Capacity Electric Pallet Stacker Support After-sales Service
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Support After Sales Service Walkie Electric Stacker 1.5 Ton With 4 Meter Triplex Mast
What is it? The power handle kit is a retrofit module that integrates a driving motor, wheel, accelerator, controller,lithium battery and harness assembly. It is designed to effortlessly convert an old manual pallet stacker into an electric power stakcer ,enable auto moving within minutes at a low cost. What are the advantages? Compact design, small size and light weight. It occupies a small area and can be carried by logistics drivers in their...
AIDA FORKLIFT EQUIPMENT CO., LTD.
Verified Supplier
Phase II Environmental Protection Technology Park, Zhentou Village,Changsha city,Hunan Province,China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Support 4ch/5ch/8ch AHD/MDVR/HDD Car Video Recording GPS 4G WiFi Truck Camera System
RICHMOR top sale MDR8114 mobile dvr with USB port for upgrade, mdvr with CMS, bus dvr connect with 4G Product Description Products Advantage: 720P AHD resolution video mobile dvr for vehicle with gps 3g; gps 3g 4g wifi g-sensor mobile dvr with ahd resolution; 4g 3g gps ahd mobile dvr support fuel sensor and RFID etc; Outstanding funtions Parameter Data Sheet Item Parameter OS Linux Language Chinese/English/Others(can be customized) Video...
Shenzhen Richmor Technology Development Co., Ltd.
Verified Supplier
6th Floor, NO.5 Building, LongBi industrial Park, Dafa Road, BanTian, Longgang, Shenzhen,China P.C 518129
Webasto Diesel 2kw 5kw Heater 12v 24v Truck Cab Parking eberspacher Air Heater
Detailed Images Our Company JP China Trade Int'l Ltd. involves the whole china of supply, from manufacturing to sales and after-sales services. Our heaters are sold to such countries as Russia, Ukraine, Sweden, Norway, German, Canada, America, New Zealand and others. And we have exclusive agency in UK and Australia. Parking heaters can be used for cars, Bus, Motorhomes, Trucks, Campers, Boats and yachts, etc. There are mainly two types of...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Submit “truck mounted drill rig for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
Hot Products :
