Business license check OK
1 - 10 Results for top grade human hair from 14011 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Calcitriol Chemical Grade Vitamin Calcitriol CAS 32222-06-3
99% Calcitriol Chemical Grade Vitamin Calcitriol CAS 32222-06-3 Calcitriol is a hormone and the active form of vitamin D in the human body. It is produced in the kidneys from its precursor, 25-hydroxyvitamin D, through a series of enzymatic reactions. Calcitriol plays a crucial role in the regulation of calcium and phosphorus levels in the body. Calcitriol acts primarily in the intestines, where it enhances the absorption of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical Grade 99% Purity Loratadine Raw Powder CAS 79794-75-5
Pharmaceutical Grade Loratadine CAS 79794-75-5 Raw Powder 99% Purity Loratadine Antiallergy drug loratadine is a commonly used anti-allergy drug, belonging to the second generation of long-acting tricyclic antihistamines, which has fast acting and strong effect and does not contain hormones. After absorption by the human body, it is metabolized into desloratadine with stronger activity, which can competitively inhibit histamine H1 receptor and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical Grade 10mg Motsc Mots-C Human Acetate Peptide Powder CAS 1627580-64-6
Mots-C CAS 1627580-64-6 Description: WHAT IS MOTS-c? MOTS-c is known to regulate metabolic functions throughout the body, including turning glucose into usable energy. MOTS-c is a relatively new peptide of 16 amino acids that promote metabolic balance. It regulates metabolic functions throughout the body. For instance, it turns glucose into usable energy. The DNA in the cell nucleus encodes most peptides. But, the mitochondria's DNA encodes MOTS...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
2.5L Antioxidant Alkaline Water Pitcher Filter Pot 1.5kg Bpa Free
2.5 Liters Antioxidant Alkaline Ionized Water Filter Pot Design Features: 1. Simple for use 2. without installation 3. Small size and convenient operation 4. Keeping in the fridge and enjoy ice water in the summer. 5. Coconut shell active carbon and mineral filters 6. Food grade materials 7. BPA FREE Features: pH alkaline water: Remove acidic substances in the body. Regulate the acid base balance of human body and improve acidic physique. Small...
EHM Group Ltd
Verified Supplier
Building 1, No. 3 of Xianke First Road, Huadong Town, Huadu District, Guangzhou City, Guangdong Province, China
Submit “top grade human hair” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
