Business license check OK
1 - 10 Results for sea transportation to chile from 11111 Products
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
CAS 52232-67-4 Cosmetic Peptide Teriparatide Acetate 98% Safe Delivery
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99%Min Assay Teriparatide Acetate Cosmetic Peptide CAS 52232-67-4 With Safe Custom
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3 19356-17-3
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Best Price Calcifediol 25-Hydroxyvitamin D3 CAS 19356-17-3 With Safe Delivery
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Factory Price API Raw Material Vitamin D Calcitriol Powder CAS 32222-06-3 Calcitriol With Safe Delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Wholesale Pharmaceutical API Materials Vitamin D3 Bulk Calcitriol Powder CAS 32222-06-3 Calcitriol
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Wholesale Nutrition Supplement Calcitriol CAS No 32222-06-3 Calcitriol with safe delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Wholesale Nutrition Supplement Calcitriol CAS No 32222-06-3 Calcitriol with safe delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Beauty Salons Sell Anti-Aging, Sleep Aid Peptide Epithalon CAS 307297-39-8 with high quality
English name epithalon Cas number 307297-39-8 Synonyms Epitalon;Epithalon;Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspartylglycine;9: PN: WO02090380 PAGE: 55 claimed protein;L-Alanyl-L-α-glutamyl-L-α-aspartylglycine;Epithalon, Epithalon Tetra Peptide;EpithalonAcetate Purity 99% delivery 8-12days Delivery time Next day of payment Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Submit “sea transportation to chile” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
