Business license check OK
1 - 10 Results for power tools hot air guns from 138235 Products
PCB Handling Equipment HS-800 BGA Rework Station with Hot Air Mounting Head Integration
PCB Handling Equipment HS-800 BGA Rework Station with Hot Air Mounting Head Integration Specification BGA Rework Station Model:HS-800 Heater power Top heater 1200W(Max), bottom heater 1200W(Max) Bottom Pre-Heating IR 5000w Temperature control K-type thermocouple,close loop control Locating way Outer or location hole Overall dimension L970mm*W700mm*H830mm PCB size W650*D610mm BGA size Max 80mm*80mm Min 1mm*1mm Applicable PCB thickness 0.3 - 5mm...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
PCB Handling Equipment with L~R Transport Direction, 1-4 Pitch Selection, and 0.05kW Power - Automatic Width Adjustment
PCB Handling Equipment with Transport Direction L~R/R~L, Pitch Selection 1-4 and Power 0.05kW Technical Details Transport height 910±20mm Transportation direction L~R, or R~L Board cycle time Approx 20 seconds Magazine change over time Approx 30seconds Track fixed side Front side Operation side Front side PCB thickness Min 0.6mm Pitch selection 1-4(10mm pitch) Power supply 220V,50/60Hz,±10% Power 0.05kW Air pressure 4-6Bar Air consumption Max...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
PCB Handling Equipment with R~L Transport Direction, 1-4 Pitch Selection, and 0.05kW Power
PCB Handling Equipment with Transport Direction L~R/R~L, Pitch Selection 1-4 and Power 0.05kW Technical Details Transport height 910±20mm Transportation direction L~R, or R~L Board cycle time Approx 20 seconds Magazine change over time Approx 30seconds Track fixed side Front side Operation side Front side PCB thickness Min 0.6mm Pitch selection 1-4(10mm pitch) Power supply 220V,50/60Hz,±10% Power 0.05kW Air pressure 4-6Bar Air consumption Max...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Self-Detection System Alarm Automatically With Air Pressure Supply Hot Sealing External Vacuum Packing Machine
Self-Detection System Alarm Automatically With Air Pressure Supply Hot Sealing External Vacuum Packing Machine Introduction This external vacuum packing machine using upper and down hot sealing packing method, the whole machine is made of painted shell, also can be customized using stainless steel. The platform is adjustable to choose the right height you need, slience wheel for the machine movement. Specification Model VS-600WB Packing capacity...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Air Pressure Supply Hot Sealing Vacuum Packing Machine Floor Standing Upper And Down
Floor Standing Upper and Down Hot Sealing Vacuum Packing Machine Introduction This external vacuum packing machine using upper and down hot sealing packing method, the whole machine is made of painted shell, also can be customized using stainless steel. The platform is adjustable to choose the right height you need, slience wheel for the machine movement. Features 1, Compare with the standard external packing machine, this unit machine using hot...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
5pcs Travel Makeup Brushes Set With 100% Synthetic Hair And Aluminium Ferrule Plastic Handle Beauty Tools
5pcs Travel Makeup Brushes Set With 100% Synthetic Hair And Aluminium Ferrule , Plastic Handle Beauty Tools Size As the picture shows Or custom Brand Our Brand (Eliz&Bella) Customer Brand(Your Brand) Color As the picture shows custom Brush Material Synthetic Hair Handle Material Wooden handle Delivery time 1-3 days for in stock(have stock , ship fast), 40-60 days for (Custom Service) Shipping method By Air (DHL, FedEx, UPS, TNT), By Sea, By...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
MSG® Centac® High Pressure Centrifugal Air Compressor
Model Specifications ModelName Flow (m3min / cfm) Height (cm / in) Width (cm / in) Length (cm / in) Rated Pressure (barg / psig) Nominal Power (kW / hp) Weight (kg / lbs) 2ASB 93-130 / 3300-4600 188 / 74 226 / 89 531 / 209 17.2-22.9 / 245-325 746-1306 / 1000-1750 9979 / 22,000 2CII 85-130 / 3000-4600 188 / 74 229 / 90 480 / 189 10.5-24.6 / 150-350 597-1306 / 880-1750 9299 / 20,500 3C 142-283 / 5000-10,000 318 / 125 315 / 124 645 / 254 2.5-26.4 /...
Eastern Model Industrial ltd
Verified Supplier
No1, Yiyuan Street, Nancheng Town, Dongguan City, Guangdong Province
Submit “power tools hot air guns” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
