1 - 10 Results for ponytail human hair extension from 14004 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
8A Loose Wave Virgin Indian Hair Human Hair Extension 8-30" Length
whole sale factory price 8A loose wave virgin indian hair 100%human hair extension Human Hair Maintaining Tips: a), Don't cut the hair weft to small pieces when fixing, it makes the hair easy to be shedding. b), Don't color your extensions by yourself ; leave that to the professionals. c), Pull hair into a ponytail using a hair tie before you go to bed,so it will not get rough. d), Brush your hair several times a day, it can keep the hair away...
Ellawigss
Verified Supplier
Bright Colored Human Hair Extensions , Blonde Human Hair Extensions
Bright Colored Human Hair Extensions , Blonde Human Hair Extensions 1. Hair Features : 1) Material : 100% Russian virgin Human hair . 2) Weight :100gram / bundle 3) Human hair Length : 10"-30" available in stock ( We measure the length of hair when the hair be stretched to straight .) 4) Human hair Color : #613 Blonde 5) Style : silky straight , Body wave 6) Quality : 7A Hair , No shedding , No tangling , No smell 7) Quality2 : Can be dyed and...
Ellawigss
Verified Supplier
Heat Resistant Remy Human Hair Extensions Unprocessed Kinky Curly Hair
Remy Human Hair Extensions Can Be Styled With Heat Tools No Shedding 100% Human Hair Product Description Remy Human Hair Extensions Remy Human Hair Extensions are high quality, natural looking hair bundles with closure that can be customized to fit your unique style. These extensions are made from 100% human hair and can last for 1-2 years with proper care. They are perfect for those who want to add length, volume, or color to their hair without...
Jinan Xuanzi Human Hair Limited Company
Verified Supplier
Xingfu Road Licheng District Jinan City, Shandong Province
Wrap Around Straight Hair Ponytail Straight Hair Extension Clip in 22 Inch human Hair Ponytails Blonde Color
Video : https://youtube.com/shorts/ol30L9yPyeQ?feature=share Wrap Around Straight Hair Ponytail Straight Hair Extension Clip in 22 Inch human Hair Ponytails Blonde Color Hair Items Wrap Around Straight Hair Ponytail Straight Hair Extension Clip in 22 Inch human Hair Ponytails Blonde Color Hair Features 1. 100% Human Hair 2. 100% Cuticle Aligned Hair 3. 100% Unprocessed Virgin Hair 4. 100% Healthy Hair from Young Girls 5. 100% Directly Factory...
Qingdao Yu Beauty hair product Co.,Ltd
Submit “ponytail human hair extension” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!