1 - 10 Results for ombre weave hair for sale from 10174 Products
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Long Lasting Handing Soft Ombre Colored Human Hair Straight Bundles Product Description 1. No Shedding: Our extensions are made with the highest quality human hair, ensuring minimal shedding. 2. No Tangle: Our extensions are carefully crafted to prevent tangling, making them easy to manage and maintain. 3. No Smell: Our extensions are made from natural human hair, free from any chemical or synthetic smells. 4. Can Be Dyed: Our extensions can be...
Jinan Xuanzi Human Hair Limited Company
Verified Supplier
Xingfu Road Licheng District Jinan City, Shandong Province
3 Tone Brazilian Ombre Color Hair / Ombre Colorful Hair 7A Grade
3 Tone Brazilian Ombre Color Hair / Ombre Colorful Hair 7A Grade Hair Weft , Hair Extension , Hair Bundles , Hair Weaving Information : 1. Hair Products : Brazilian Virgin Hair , Human Hair Weaves, Brazilian Hair Weave Bundles Ombre, 7A Ombre Virgin Hair , Ombre Brazilian Hair Weave 2. Brazilian Virgin Body Wave Material : Raw Human Hair , Brazilian Virgin Hair Dyed Ombred , Brazilian / Malaysian / Peruvian / Indian / Chinese / European /...
Ellawigss
Verified Supplier
Body Wave Blue Ombre Color Hair 100 Peruvian Hair Weave Bundles
Body Wave Blue Ombre Color Hair 100 Peruvian Hair Weave Bundles We Believe Everyone Can and Deserves to be Beautiful ! We promise ! 1. Hair Features : 1). Material : 100% Peruvian Virgin Remy Hair , 100% Ombre Human Hair Weave , 100% Raw Human Hair Extensions 2). Hair Color : Ombre Blue Ombre Two Tone Color ( T1B / Blue ) 3). Hair Length : 10" - 30" Mixed Length Available Ombre Hair Extensions 4). Hair Style : Body Wave , Silk Straight , Loose...
Ellawigss
Verified Supplier
Stock Ombre Virgin Hair Weave / Ombre Human Hair Weave With Closure For Women
Stock Ombre Virgin Hair Weave / Ombre Human Hair Weave With Closure For Women Specifications: Hair Material : 100% Virgin Human Hair Hair Grade: 6a 7A 8a Virgin Remy Hair weave Color: 1b / 30 color (Any colors available) Life Time 12-24 months if well cared. Available Length 12inch ~ 30inches in stock, other length can be customized. Net Weight: About 3.5 oz / pcs , about 100 grams Samples: Samples testing order available on the basic of stock...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
613 Blonde 100% Ombre Peruvian Hair Bundles / Ombre Blonde Hair Weave No Shedding CamScanner 2021-05-31 17.42.pdf download 1b / 613 Blonde 100% Ombre Peruvian Hair Bundles / Ombre Blonde Hair Weave No Shedding 1. Our Service 1. 2.More than good system design! 90-240V wide voltage support EMC anti-electromagnetic interference design Perfect combination of mechanics and material science, anti-vibration design * The light source cavity and the power...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Two Tone Real Ombre Human Hair Extensions 14 - 24 Inch Virgin Hair Permed
Two Tone Real Ombre Human Hair Extensions 14 - 24 Inch Virgin Hair Permed Product Specification Hair Material 100% human hair of young girls Advantages 1) Double drawn strong weft, no shedding human hair weave 2) Natural cuticle, tangle free No tangle no shed hair weave 3)Can be ironed and restyled No tangle no shed hair weave 4)Full ends, no splits No tangle no she hair weave 5)Very clean, smooth ,soft, comb easily. colored brazilian hair weave...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
No Tangle Machine Weft Ombre Real Hair Extensions / Ombre Loose Wave Weave
No Tangle Machine Weft Ombre Real Hair Extensions / Ombre Loose Wave Weave Specifications: Item Golden Blonde Ombre Human Hair Item No OBWBW Material 100% Brazilian human hair Grade 7A grade Color 1b / 613# , Black / Blonde Texture loose wave/ Natural /body wave; deep wave/curly;straight , afro curly Weight 100g per piece Lenght 12-30 inch available in stock. other length need custom made Quality Can be dyed,curled... no tangle,no shedding no...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Ombre Color Hair Extensions
Silk Straight Hair Ombre Color Hair Unprocessed 2 Tone Color 1B / Red Hair Weave 1. Hair Features : a). 100% human hair , virgin hair b). No shedding , No Tangle , No Smell , Double Strong Machine Weft c). Full Length , Thick Bottom , No Dry , No Split and Healthy End . d). Asteria Hair Human Hair , Hair Extensions , Human Hair Weave e). More than 10 years factory price for unprocessed ombre color hair bundles f). Promise : The certification...
12'' - 30'' Length Grade 6a brazilian hair / ombre straight hair weave Specifications: Material 100% Virgin Human Remy Hair Hair type Malaysian hair,indian hair,peruvian hair,brazilian hair,cambodian hair....ect Color Main color is Natural color (1b) Ombre hair: 1b/30#, 1b/27#, 1b/613#, 1b/99j, 1b/gray other colors can be customized Grade AAAAAA Virgin Remy Human Texture Pattern Tight curl,body wave,Deep wave,big curl,Natural wave,Natural...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Submit “ombre weave hair for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!