Business license check OK
1 - 10 Results for nature weave human hair from 17295 Products
Vitamins Melatonine CAS-73-31-4 Fade Black Freckle Natural Whitening
Melatonin is an indispensable natural hormone in the human body, which controls and affects the secretion of different hormones. When melatonin is reduced in the body, various functions of the human body will be affected, and various diseases will follow. Studies have shown that the secretion of melatonin in the human body begins to decrease after middle age, and by old age, its secretion has been slightly abnormal. Early intake and supplement...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Natural Product Improve Rickets Osteomalacia 25-Hydroxyvitamin D3 CAS-19356-17-3
Natural Product Improve Rickets Osteomalacia 25-Hydroxyvitamin D3 CAS-19356-17-3 25-Hydroxyvitamin D3 is converted from vitamin D3(VD3) in the human body under the action of VD3 hydroxylase in the liver, sensitive to air, heat and light, easily soluble in polar organic solvents such as ethanol, but insoluble in water. 25-Hydroxyvitamin D3 is suitable for the treatment of osteoporosis, rickets, osteomalacia and other metabolic bone diseases, and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Anti Tumor Natural Dacomitinib Powder CAS 1110813-31-4 Pharmaceutical Raw Materials
Natural Product Dacomitinib CAS-1110813-31-4 Pharmaceutical Raw Materials Anti-Tumor Dacomitinib can Causes significant antitumor activity, including significant tumor regression in various human tumor xenotransplantation models. Name Dacomitinib CAS 1110813-31-4 Molecular formula C24H25ClFN5O2 Molecular weight 469.94 Storage condition Refrigerator Structural Formula Company profile Xingtai Xinzhou Technology Co., Ltd. is a registered...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Natural Product Antineoplastic Drugs Dacomitinib (PF299804) CAS-1110813-31-4
Dacomitinib can Causes significant antitumor activity, including significant tumor regression in various human tumor xenotransplantation models. Name Dacomitinib CAS 1110813-31-4 Molecular formula C24H25ClFN5O2 Molecular weight 469.94 Storage condition Refrigerator Structural Formula Company profile Xingtai Xinzhou Technology Co., Ltd. is a registered enterprise approved by the relevant state departments. Located in Xingtai City, Hebei Province...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
5 Pieces Beauty Makeup Brush Aluminium Ferrule Cosmetic Brushes Transprent Plastic Handle
5 Pieces Beauty Makeup Brush ,Aluminium Ferrule Cosmetic Brushes,Transprent Plastic Handle Description: EYA ultimate 5 pieces essential makeup brushes set is a full set of premium quality makeup brushes for cosmetics professionals, but equally handy for everyday use and people who are learning the art of makeup. Made with natural animal hair and superior synthetic hair, this unique brush set provides an incredible touch and feel, leaving a...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
Raw Material Of Cosmetics Melatonine Powder CAS 73-31-4 Skin Whitening Product
Melatonin is an indispensable natural hormone in the human body, which controls and affects the secretion of different hormones. When melatonin is reduced in the body, various functions of the human body will be affected, and various diseases will follow. Studies have shown that the secretion of melatonin in the human body begins to decrease after middle age, and by old age, its secretion has been slightly abnormal. Early intake and supplement...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
High Purity Vitamins Melatonine CAS-73-31-4 Treat Insomnia Health Care Products
High Purity Vitamins Melatonine CAS-73-31-4 Treat Insomnia Health Care Products Melatonin is an indispensable natural hormone in the human body, which controls and affects the secretion of different hormones. When melatonin is reduced in the body, various functions of the human body will be affected, and various diseases will follow. Studies have shown that the secretion of melatonin in the human body begins to decrease after middle age, and by...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Raw Material Of Cosmetics Melatonine Powder CAS-73-31-4 Anti-Aging Antioxidant
Melatonin is an indispensable natural hormone in the human body, which controls and affects the secretion of different hormones. When melatonin is reduced in the body, various functions of the human body will be affected, and various diseases will follow. Studies have shown that the secretion of melatonin in the human body begins to decrease after middle age, and by old age, its secretion has been slightly abnormal. Early intake and supplement...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Submit “nature weave human hair” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
