Business license check OK
1 - 10 Results for lpg delivery truck from 26933 Products
CAS 52232-67-4 Cosmetic Peptide Teriparatide Acetate 98% Safe Delivery
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Best Price Calcifediol 25-Hydroxyvitamin D3 CAS 19356-17-3 With Safe Delivery
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Factory Price API Raw Material Vitamin D Calcitriol Powder CAS 32222-06-3 Calcitriol With Safe Delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Wholesale Nutrition Supplement Calcitriol CAS No 32222-06-3 Calcitriol with safe delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Wholesale Nutrition Supplement Calcitriol CAS No 32222-06-3 Calcitriol with safe delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Tirzepatide 5mg 10mg 15mg For Lose Weight CAS 2023788-19-2 With Safe Delivery
Products Description English name Tirzepatide Cas number 2023788-19-2 Synonyms Tirzepatide;GIPGLP-1;Tirzepatide (LY3298176);Trizepatide;GipGLP-1 Tirzepatide Ly3298176 Peptide;Tilposide;Tirzepatide(GLP-1);terzapitide Purity 99% delivery 8-12days Delivery time Next day of payment Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Tirzepat.ide (LY3298176) is a glucose-dependent in sulin nutrient polypeptide (GIP)...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Customized Content And Label Stickers Weight Loss Tirzepatide GLP-1 With Safe Delivery
Products Description English name Tirzepatide Cas number 2023788-19-2 Synonyms Tirzepatide;GIPGLP-1;Tirzepatide (LY3298176);Trizepatide;GipGLP-1 Tirzepatide Ly3298176 Peptide;Tilposide;Tirzepatide(GLP-1);terzapitide Purity 99% delivery 8-12days Delivery time Next day of payment Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Tirzepat.ide (LY3298176) is a glucose-dependent in sulin nutrient polypeptide (GIP)...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Portable 2KW Diesel Air Heater 12V parking heater for campervan truck boat
Product Description Specification item value OE NO. NO Size 560*340*440mm Warranty 1 year Place of Origin China Car Model UNIVERSAL Heater size 560*340*440mm Heater power 2KW Voltage 12V Fuel Diesel Packing & Delivery the parking heater was in a single carton box, the parking heater spare parts were packed in the other carton, two cartons intotal Company Profile JP China Trade Int'l Co., Ltd. was founded in Beijing and is a Russian-Chinese joint...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Fast Delivery JP Webasto Air Parking Heater 2000W 2KW 12V Gas For RV Truck Cabin Heater
Product Description Fast Delivery JP Webasto Air Parking Heater 2000W 2KW 12V Gas For RV Truck Cabin Heater In winter, the windows of your car/vehicle are often icy or frosted which will block your view, and you may need to scrape the windscreen by your hands. Next, sitting on the cold seat, you have to drive your car/transportation with frozen hands in a freezing cabin. Just install a parking heater, all those problems will go away! A 2KW 12V...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Portable 2KW Diesel Air Heater 12V parking heater for campervan truck boat
Product Description Specification item value OE NO. NO Size 560*340*440mm Warranty 1 year Place of Origin China Car Model UNIVERSAL Heater size 560*340*440mm Heater power 2KW Voltage 12V Fuel Diesel Packing & Delivery the parking heater was in a single carton box, the parking heater spare parts were packed in the other carton, two cartons intotal...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Submit “lpg delivery truck” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
