Business license check OK
1 - 10 Results for indian remy human hair wig from 12355 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Unprocessed 100% Indian Full Lace Black Human Hair Wigs Straight Remy Human Hair Wigs
Unprocessed 100% Indian Full Lace Black Human Hair Wigs Straight Remy Human Hair Wigs Specifications: Density 130% Color of hair 1b/99j Size of caps S,M,L Color of Lace transparent,light brown,medium brown,dark brown Baby Hair on the front Yes Bleached Knots Yes Elastic net Yes Deliver day within 24 hours,big quantities within 7-10days Payment Paypal,T/T,Western Union,Money Gram ,Escrow Sample order Accepted Features: 1 there are many hairstyles...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Unprocessed 100% Indian Straight Human Hair Wig Full Lace Black
Unprocessed 100% Indian Full Lace Black Human Hair Wigs Straight Remy Human Hair Wigs Specifications: Density 130% Color of hair 1b/99j Size of caps S,M,L Color of Lace transparent,light brown,medium brown,dark brown Baby Hair on the front Yes Bleached Knots Yes Elastic net Yes Deliver day within 24 hours,big quantities within 7-10days Payment Paypal,T/T,Western Union,Money Gram ,Escrow Sample order Accepted Features: 1 there are many hairstyles...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Full Lace Black Indian Curly Human Hair Wigs 30 Inch Body Wave human hair
Full Lace Black Indian Curly Human Hair Wigs 30 Inch Body Wave human hair Hair duration 1-2 years Length 8 Inches - 30 Inches Color 1B#,natural color Payment Western Union, MoneyGram, T/T,Paypal hair pattern Straight Original Indian Deliver Time 2-3 days to US ,Europe ; 3-5 days to Africa Density 130% Competitive Advantage: 1. Factory with 20 years experience 2. 100%human hair ,no mix. 3. Retail/Wholesale/OEM / ODM available 4. Steady product...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Full Lace Black Indian Curly Human Hair Wigs 30 Inch Body Wave human hair
Full Lace Black Indian Curly Human Hair Wigs 30 Inch Body Wave human hair Hair duration 1-2 years Length 8 Inches - 30 Inches Color 1B#,natural color Payment Western Union, MoneyGram, T/T,Paypal hair pattern Straight Original Indian Deliver Time 2-3 days to US ,Europe ; 3-5 days to Africa Density 130% Hair 1. No tangle, shedding free ,no any smell 2. Wholesale, retail, dropship available 3. Large stock and 24h fast delivery 4. Customzied package...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Submit “indian remy human hair wig” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
