Business license check OK
1 - 10 Results for human hormone growth injections from 1152 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
121062-08-6 Cosmetic Peptide Mt2 Melanotan Ii Injectable Peptides For Anti Aging
Mt2 Melanotanii CAS 121062-08-6 Injectable Peptides For Anti Aging Melanotan 2 (CAS NO. 121062-08-6) was first synthesized at the University of Arizona. Researchers decided to find a more potent and stable alternative, one that would be more practical to defenses against skin cancer. Melanotan 2I acts as a non-selective agonist of the melanocortin receptors. Melanotan II is a peptide hormone belonging to the alpha-melanocyte-stimulating hormone...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
BPC-157 Protein Peptide Hormones CAS 137525-51-0 2mg 10mg/Vial
BPC-157 Protein Peptide Hormones CAS 137525-51-0 2mg 10mg/Vial The pleiotropic beneficial effects of stable gastric pentadeceptide BPC157 have been reported in multiple organ systems. BPC157 is a natural gastric pentapeptide, which is non-toxic and has deep cytoprotective activity and has been used in ulcerative colitis and multiple sclerosis tests. In human gastric juices, ChemicalbookBPC157 is stable for more than 24 hours, so it has good oral...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Weight Loss GLP-1 Injection Peptide 99% Purity Glp1 Agonist Tirzepatide
Weight Loss GLP-1 Injection Peptide 99% Purity glp1 agonist Tirzepatide Semaglutide has a chemical structure that is very similar to the hormone glucagon-like peptide 1 (GLP-1), adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes. Semaglutide may help people with obesity lose weight as well. SEMAGLUTIDE & TIRZEPATIDE GLP-1 agonists were approved by the FDA for weight loss in late 2014. It's a newer class of...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Plant Rooting Hormone 98% TC trans-zeatin Plant Growth Regulators for Optimal Growth
trans-zeatin 98% TC plant growth regulator Product name trans-zeatin transzeatin zeatin 99%TC cytokinin plant hormone growth regulator cas 1637-39-4 General info Product Name trans-zeatin CAS No. 1637-39-4 Classification Plant Growth Regulator/Agrochemical Species 99%TC Chemical Name trans-6-(4-Hydroxy-3-methylbut-2-enylamino) purine, Zeatin, trans-Zeatin Properties Appearance: White crystal powder Molecular formula: C10H13N5O Molecular weight:...
Averstar Industrial Co., Ltd. SZ
RM 1906, Building B, Zhaotao Tech Tower, Minzhi RD., Longhua Dist., Shenzhen, Guangdong, China.
High Effect Hormone Sodium Nitrophenolate 98% Purity for Plant Growth Regulation
plant growth regulator Compound Sodium Nitrophenolate 98% Product name compound sodium nitrophenolate 98%TC 1.8%AS plant hormone growth regulator General info Common name: Compound Sodium Nitrophenolate Chemical name: 2-Nitrophenol sodium salt CAS No : 824-39-5 Molecular Formula: C6H4NNaO3 Formula weight: 161.09 Specification: 98%TC Properties Common name: Compound Sodium Nitrophenolate Chemical name: 2-Nitrophenol sodium salt CAS No : 824-39-5...
Averstar Industrial Co., Ltd. SZ
RM 1906, Building B, Zhaotao Tech Tower, Minzhi RD., Longhua Dist., Shenzhen, Guangdong, China.
Gibberellic Acid 10% Tablet for Plant Growth Regulator MF 77-06-5 State GRANULAR
Product Name Gibberellic acid 10% tablet, gibberellin 20%tb, ga3 tablets 10% CAS NO. 77-06-5 Formulation 10%tablet. 20%tablet Application 1. ga3 tablet belongs to a natural plant hormone. 2. ga3 tablet can stimulate plant stem elongation by stimulating cell division and elongation. 3. ga3 tablet can break seed dormancy, promote seed germination. or cause parthenocarpic (seedless) fruit. seedless grape. Seedless watermelon 4. ga3 tablet has been...
Averstar Industrial Co., Ltd. SZ
RM 1906, Building B, Zhaotao Tech Tower, Minzhi RD., Longhua Dist., Shenzhen, Guangdong, China.
MF C12H10O2 NAA TC 1-Naphthaleneacetic acid 98% TC Plant Growth Regulator for Plants
Plant Growth Regulator NAA TC 1-Naphthaleneacetic acid 98% TC hormones Product Name NAA-Na CAS No. 86-87-3 Classification Plant Growth Regulator/Agrochemical Chemical Name 1-Naphthaleneacetic acid sodium salt, sodium 1-naphthal acitic acid,sodium a-naphthalene acetic acid Physical chemistry Molecular formula: C12H9 NaO2 Molecular weight: 186.21 M.P.: 134-135 Degree C Appearance: off-white powder Assay:98%min Loss on drying: 0.5%max Residues after...
Averstar Industrial Co., Ltd. SZ
RM 1906, Building B, Zhaotao Tech Tower, Minzhi RD., Longhua Dist., Shenzhen, Guangdong, China.
GRANULAR Gibberellic Acid Stable and Highly Effective Plant Growth Promoter
Product Description Gibberellic acid (GA) is one of the major hormones that can be synthesized in plants and fungi. It has various kinds of physiological effects including stimulating seed germination, inducing mitotic division of the leaves, triggering transitions from meristem to shoot growth, vegetative to flowering, determining sex expression and grain development through crosstalk with many environmental signals such as light, temperature...
Averstar Industrial Co., Ltd. SZ
RM 1906, Building B, Zhaotao Tech Tower, Minzhi RD., Longhua Dist., Shenzhen, Guangdong, China.
Submit “human hormone growth injections” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
Hot Products :
recombinant human epidermal growth factor
human chorionic gonadotropin injection for men
hormonal hair growth treatment
injection for muscle growth
hormonal acne natural treatment
hormonal imbalance in men
natural hormonal acne treatment
hormonal imbalance in women
hormonal treatment for prostate cancer
hormonal treatment for breast cancer
