Business license check OK
1 - 10 Results for human hair virgin from 11860 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
100% Real Human Hair Virgin Peruvian Hair Weave Body Wave Unprocessed
100% Real Human Hair Virgin Peruvian Hair Weave Body Wave Unprocessed 1.Hair Feautures: We are selling 100% human hair,Peruvian virgin hair weave,Peruvian hair virgin,unprocessed virgin Peruvian hair,virgin human hair,remy virgin hair,Peruvian remy hair. Hair Material: 100% virgin Peruvian hair Hair Grade: Grade AAAAAA virgin hair Hair Length: 10",12'', 16”,18'', 20'', 22'', 24'', 26'', 28'',30",32". Hair Weight: 100g/piece Hair Style: Silk...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Short Full Lace Wigs Human Hair / Virgin Hair Full Lace Wigs For White Women
Short Full Lace Wigs Human Hair / Virgin Hair Full Lace Wigs For White Women We sincerely hope to establishing business relationship with you , Welcome to contact us ! 1. Why Choose Us : 1). Manufacture with more than 10 years experience 2). 100% virgin human hair , no chemical process 3). High quality certicate for wholesale / OEM available 4). Large stocks for your urgent demand 5). Quick delivery ( within 24 hours in stock ) 6). Special...
Ellawigss
Verified Supplier
Virgin Remy Hair Extensions Real Human Hair , Virgin Weave Hair Extension
Virgin Remy Hair Extensions Real Human Hair , Virgin Weave Hair Extension 1. Hair Features : Hair Extension : 100% Virgin Brazilian Human Hair Weave Hair Length : 10 " - 28 " Stock Hair Length : 8”,10”,12'', 16”,18'', 20'', 22'', 24'', 26'',28”,30”,32”,34”,36”,38”,40” Hair Color : Natural Black Stock Hair Color : Natural Brown , Jet Black , Natural Black , Blonde Color , etc Hair Type : 100% Virgin Brazilian hair Hair Quality : Grade AAAAAAA...
Ellawigss
Verified Supplier
Dyed Bleached Peruvian Human Hair Virgin Peruvian Hair Extensions
Remy Hair 6A Grade and Hair Extension Type 100% Virgin Real Peruvian Natural Wave Human Hair Material straight human hair weaving Length 12''-30'' available (you can also get the updated stock list from salesman) Color Natural color (other colors can be customized) Texture Straight (romance curl,body wave,deep wave, loose wave, natural wave,curly, spring curl, spiral curly,are available) Weight About 100g/3.5oz per piece or bundle MOQ 3 pieces...
Ellawigss
Verified Supplier
Submit “human hair virgin” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
Hot Products :
virgin indian human hair
malaysian virgin remy human hair
100 percent virgin human hair
what is virgin remy human hair
brazilian virgin remy unprocessed human hair
virgin human hair bundles
virgin human hair extensions
virgin brazilian human hair
virgin human hair weave
virgin unprocessed human hair
