Business license check OK
1 - 10 Results for human hair milky way from 12763 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Raw materials for medical and health care products Urolithin A CAS-1143-70-0
Raw materials for medical and health care products Urolithin A CAS-1143-70-0 A substance called UrolithinA found in pomegranates and other fruits may help slow certain aging processes by improving the function of cellular mitochondria. In addition, there is no risk to human health from ingesting this Chemicalbook compound. Studies have shown that urolixin A stimulates mitochondrial biogenesis in the same way as regular exercise, and is the only...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Anti Inflammatory Cell Biology Reagent Urolithin A Powder Anti Aging CAS 1143-70-0
Anti-Inflammatory Cell Biology Reagent Urolithin A Anti-Aging CAS-1143-70-0 A substance called UrolithinA found in pomegranates and other fruits may help slow certain aging processes by improving the function of cellular mitochondria. In addition, there is no risk to human health from ingesting this Chemicalbook compound. Studies have shown that urolixin A stimulates mitochondrial biogenesis in the same way as regular exercise, and is the only...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Medical Raw Materials 3,8-Dihydroxy-6H-Dibenzo(B,D)Pyran-6-One CAS-1143-70-0
Medical Raw Materials 3,8-Dihydroxy-6H-Dibenzo(B,D)Pyran-6-One CAS-1143-70-0 A substance called UrolithinA found in pomegranates and other fruits may help slow certain aging processes by improving the function of cellular mitochondria. In addition, there is no risk to human health from ingesting this Chemicalbook compound. Studies have shown that urolixin A stimulates mitochondrial biogenesis in the same way as regular exercise, and is the only...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Colored Bundles Remy Ombre Human Hair Extensions Double Drawn
Colored Bundles Remy Human Hair Extension Double Drawn Human Hair Product Description Looking for a way to add some color to your hair without the commitment of dyeing? Look no further than our Ombre Human Hair Extensions! Product Overview Our Ombre Human Hair Extensions are a must-have for anyone looking to add a pop of color to their hair. Made from 100% human hair, these extensions are not only beautiful but also easy to maintain. With a...
Jinan Xuanzi Human Hair Limited Company
Verified Supplier
Xingfu Road Licheng District Jinan City, Shandong Province
Submit “human hair milky way” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
