Business license check OK
1 - 10 Results for human hair lace fronts from 12719 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Virgin Human Hair Lace Front Wigs No Shedding For Black Woman , Medium Brown Color
Virgin Human Hair Loose Wave Lace Front Wigs No Shedding No Tangling For Black Woman Soft Our Feature Our hair are specilize in 100% virgin human hair. Our hair are cutting from young girl,unprocessed. Our hair can be dyed and bleached well to any color you want. Our virgin hair can be ironed and styled as you request. Specifications: Product Brazilian Lace Front Wigs Virgin Human Hair Lace Front Wigs for Black Women Features 1. 100% real hair,...
Ellawigss
Verified Supplier
Blonde Color Brazilian Human Hair Lace Front Wigs With Baby Hairline 10 Inch-30 Inch
Blonde Color Brazilian Human Hair Lace Front Wigs Straight With Baby Hair 130% Real Density Product description : Hair Length: 10inch-30inch Hair Color: Dark Color: 1# 1B# 2# #613 Hair Material: 100% human and virgin hair (Russian hair, Indian hair, Brazilian hair, Mongolian hair, Malaysian hair or European hair). Hair Density: 130%-180% Hair Style: deep wave, water wave,loose wave , deep curl, jerry curl, natural straight, yaki straight or...
Ellawigss
Verified Supplier
Curly Front Lace Wigs / 100 Human Hair Lace Front Wigs Blonde Wigs Human Hair
Curly Front Lace Wigs / 100 Human Hair Lace Front Wigs Blonde Wigs Human Hair 1. Advantage of Brazilian Human Lace Frontal Wigs : 1). Adjusting easily and suitable for different people 2). Solid combs to firm the cap 3). Natural hair line with baby hair 2. Specifications : Product Name Brazilian Human Hair Front Lace Wigs Ombre Silk Straight With Baby Hair Wigs Hair Material 100 % Remy Brazilian hair Hair Length 8 " - 24 " Hair Texture Silk...
Ellawigss
Verified Supplier
Curly Glueless Human Hair Lace Front Wigs #613 Color With 130% Density
#613 Color Virgin Human Hair Lace Front Wigs 100% Virgin Hair Material Body Wave 130% Density Types HAKKA virgin full lace wig Style body wave Brand HAKKA Donor Source From the healthiest donor Life Span More Than One Year With Proper Care Color Blonde 613 Unit Weight (g) 300g(+/-5g) Length Range 12"-34" Available Warehouse Location China & New York City Other Texture Straight, body wave, deep wave, natural wave, kinky curly, loose curly, kinky...
Ellawigss
Verified Supplier
Submit “human hair lace fronts” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
