Business license check OK
1 - 10 Results for human hair for african american from 11645 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Short Kinky Curly Indian Remy Full Lace Wigs Human Hair For African American Women
Medium Density Kinky Curly Brown Mix Full Lace Wig Indian Remy Human Hair for African American Women Full Lace Wig Specifcations : Hair Material 100%Remy Inidan Hair ,100% Brazilian Hair ,100%Malaysian Hair ,100%Peruvian Hair Weight 120g-200g Hair Grade 7A Premium Virgin Remy Hair Hair Length 8"-30" Hair Color #1,#1B,#2,#3,#4,#6,#8,#613 ,#4/27,Ombre Etc Customize Acceptable Hair Texture Silky Straight ,Body Wave ,Deep Wave ,Water Wave,Kinky Curl...
Shanghai Sifei Import & Export Co., Ltd.
Verified Supplier
No.2581 Hunan Rd.Pudong District Shanghair China
100% Indian Remy Deep Wave Hair Extensions Human Hair For African American Girls
3 Bundle Deep Wave 100% Indian Remy Human Hair Weft Hair Extensions For African American Girls Feature : (1) Hair Collect & Hair Material Each bundle of hair comes from an individual donor, this guarantees consistency in color and all cuticles facing in the same direction. Since virgin hair is completely natural and has never been processed, it takes the color very easily just like your natural hair. (2) Full Ends Our Hair ia hair that has been...
Shanghai Sifei Import & Export Co., Ltd.
Verified Supplier
No.2581 Hunan Rd.Pudong District Shanghair China
African American Natural Human Hair Wigs Natural Looking / ladies human hair wigs
African American Natural Human Hair Wigs Natural Looking / ladies human hair wigs Description: Hair Grade AAAAAA human hair Wigs Hair color Natural color Features 1.High quality, factory price 2.Fine,soft and silk 3.No tangling No shedding 4.100% Indian human hair Cap Machine weft with adjustable strips Available Length 6-8 inch in stock Weight 103g per piece Minimum Order We accept samples order on the basic of stocks Terms of payment We accept...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
African American Natural Human Hair Wigs Natural Looking 10 Inch
African American Natural Human Hair Wigs Natural Looking 10 Inch Description: Hair Grade AAAAAA human hair Wigs Hair color Natural color Features 1.High quality, factory price 2.Fine,soft and silk 3.No tangling No shedding 4.100% Indian human hair Cap Machine weft with adjustable strips Available Length 6-8 inch in stock Weight 103g per piece Minimum Order We accept samples order on the basic of stocks Terms of payment We accept Paypal, T/T,...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
Submit “human hair for african american” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
Hot Products :
