Business license check OK
1 - 10 Results for human hair extensions weft from 14115 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Brazilian Virgin Human Hair Afro Kinky Curly Human Hair Extension Weft Good Ratio
Brazilian Virgin Human Hair Afro Kinky Curly Human Hair Extension Weft Good Ratio Brand Name: YVONNE Hair Grade: Grade 7A Brazilian Virgin Hair Hair Material: 100% Human Hair Hair Color: Natural Color #1B Texture: Afro Kinky Curly Length: 8-30 Inches in Stock, other length could be customized. Net Weight: 100g(+/-5g)/piece Advantage: Soft, no tangle and no shedding. Our hair is 100% virgin hair without proccessing and dying. It's natural color...
Ellawigss
Verified Supplier
Double Knots Soft Real Brazilian Curly Human Hair Extensions Weft For Dream Girl
Fashionable 100% Brazilian Virgin Hair Weft Hair Extensions Natural Color Our hair advantage: 100% human hair without animal and synthetic hair. All hair are imported from various countries. All hair are made by skilled workers and advanced technology. Hair Features of Our Water wave soft hair end fuller looks more luster more natural contain protein. full of vitality keep longer curl's hold full cuticle double knots bleach knots Material 100%...
Ellawig companys
Verified Supplier
Room 501, unit 6, building 20, North Lane, east flower market, Beijing
22" Virgin Human Hair Extensions Weft for Sale, 55 CM 100 G BW Natural Virgin Remy Human Hair Weft Extensions For Sale
22" Virgin Human Hair Extensions Weft for sale, Hot Selling 55 CM 100 G BW Natural Brown Virgin Remy Human Hair Weft Extensions For Sale Hair Material 100% Human hair, Remy Virgin Human Hair. Chinese Hair, Indian Hair, Russian Hair, Brazilan Hair, Malaysian Hair. Hair Grade Remy Hair grade. Soft, smooth, shiny, free of tangle. Hair Type Virgin Human Hair Extensions Weft. Hair Weave, Hair Weft Extensions. Hair Style Body Wave. Silky Straight,...
Heze Sincere Hair Products Co., Ltd
No. 77 Zhonghua Road, Heze, 274000, China
16" Virgin Human Hair Extensions Weft for Sale, 40 CM Brazilian Natural Black Virgin Human Hair Weft Extensions For Sale
16" Virgin Human Hair Extensions Weft for sale, Hot Selling 40 CM Natural Black Virgin Human Hair Weft Extensions For Sale Hair Material 100% Human hair, Remy Virgin Human Hair. Chinese Hair, Indian Hair, Russian Hair, Brazilan Hair, Malaysian Hair. Hair Grade Remy Hair grade. Soft, smooth, shiny, free of tangle. Hair Type Virgin Human Hair Extensions Weft. Hair Weave, Hair Weft Extensions. Hair Style Natural Wave. Silky Straight, Body Wave,...
Heze Sincere Hair Products Co., Ltd
No. 77 Zhonghua Road, Heze, 274000, China
Submit “human hair extensions weft” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
