Business license check OK
1 - 10 Results for human hair afro from 11224 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Brazilian Virgin Human Hair Afro Kinky Curly Human Hair Extension Weft Good Ratio
Brazilian Virgin Human Hair Afro Kinky Curly Human Hair Extension Weft Good Ratio Brand Name: YVONNE Hair Grade: Grade 7A Brazilian Virgin Hair Hair Material: 100% Human Hair Hair Color: Natural Color #1B Texture: Afro Kinky Curly Length: 8-30 Inches in Stock, other length could be customized. Net Weight: 100g(+/-5g)/piece Advantage: Soft, no tangle and no shedding. Our hair is 100% virgin hair without proccessing and dying. It's natural color...
Ellawigss
Verified Supplier
Afro Kinky Curly Hair No Shedding , No Tangling 100% Brazilian Human Hair Extensions
Brazilian Human Hair Bundles Afro Kinky Curly No Shedding No Tangling 100% Human Hair Extension Product Specification Hair Material Virgin Brazilian hair Hair Grade 8a virgin Brazilian hair Hair Feature Smooth feeling and no tangle, no shedding Hair Advantage Extremely soft, comfortable, free tangle 100% virgin peruvian hair, virgin human hair extension Unprocessed virgin hair, Could be dyed or Bleached After washing, it return same texture No...
Ellawigss
Verified Supplier
Afro Kinky Curly Hair Peruvian Virgin Human Hair Bundles Full Density No Lice No Tangle
Afro Kinky Curly Hair Peruvian Virgin Human Hair Bundles Full Density No Lice No Tangle Item Description Hair Material 100% Virgin Human Hair, all our hair use young girl's hair. We can guarantee the quality. Peruvian hair, Mongolian hair, Indian hair, European hair, Brazilian hair, Malaysian hair, Chinese hair, etc. Hair Color natural color available Ombre hair available Other color can available such as #1/ #1B/#2 /#4 /#613 etc. Hair Texture we...
Ellawigss
Verified Supplier
Alibaba China Virgin Curl Soft Human Hair Afro Kinky Curly Weave No lice Steam Process
Alibaba China Virgin Curl Soft Human Hair Afro Kinky Curly Weave No lice Steam Process Product Details: Alibaba China Virgin Curl Soft Human Hair Afro Kinky Curly Weave No lice Steam Process Quality 1.Top quality virgin hair ; 100% virgin hair, 100% real human hair , 100% unprocessed hair ,100% Peruvian hair , young gril's hair 2.Soft, clean, healthy hair end , no lice or knit 3 no shedding, Double weft 4.No tangling, Top quality virgin hair 5...
Guangzhou Gzf Hair Company
NO.13 Beihouxijie, Renhe Town, Guangzhou City, China
Submit “human hair afro” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
