Business license check OK
1 - 10 Results for hot wax hair removal from 50421 Products
3 Inch Matte Anti Scratch Recycled BOPP Plastic Base Removing Protective Film Roll For Hot-Stamping
3 Inch Matte Anti Scratch Recycled BOPP Plastic Base Removing Protective Film Roll For Hot-Stamping Item 3 Inch Matte Anti Scratch Recycled BOPP Plastic Base Removing Protective Film Roll For Hot-Stamping Width 360-1920mm or custom Length 200-3600m or custom Thickness 18mic, 28mic Paper core 1 inch, 3 inch Material BOPP+ EVA Color Matt/glossy Advantages No any plastic, recyclable, Moisture-proof, high-light transmittance,high gloss, strong...
NEWFLM(GUANGDONG)TECHNOLOGY CO.,LTD
Verified Supplier
Tengjin Technology Park,No.7,Huaguoshan Road,XinAn community,ChangAn,Dongguan,GuangDong,China.
BOPP Plastic Removing Protective Film Varnish Easy Using For Printing
BOPP Plastic Removing Protective Film Varnish Easy Using For Printing Item Eco Friendly BOPP Plastic Removing Protective Film Varnish Easy Using For Printing And Packaging Width 360-1920mm or custom Length 200-3600m or custom Thickness Optional Paper core 1 inch, 3 inch Material BOPP+ EVA Color Matt/glossy Advantages No any plastic recycled, Moisture-proof, high-light transmittance,high gloss, strong bonding,wearable, suitable for hot-stamping...
NEWFLM(GUANGDONG)TECHNOLOGY CO.,LTD
Verified Supplier
Tengjin Technology Park,No.7,Huaguoshan Road,XinAn community,ChangAn,Dongguan,GuangDong,China.
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot sale 4.5cm real wax water activated floating candles for wedding decoration centerpiece candle holders
#detail_decorate_root .magic-0{border-bottom-width:2px;border-bottom-style:solid;border-bottom-color:#53647a;background-color:#c5ccde;margin-left:0;margin-right:0;padding-left:8px;padding-right:8px;color:#53647a;font-family:Roboto;font-size:24px;padding-top:8px;padding-bottom:4px}#detail_decorate_root .magic-1{width:750px;border-collapse:collapse}#detail_decorate_root .magic-2{min-height:28px;padding:5px 10px;overflow:hidden;width:166px;min...
PUJIANG SAIXIN DECOR LLC
Verified Supplier
208 HengSheng Road,Pujiang ,Zhejiang ,China
Hot sale good quality real wax LED pillar candle for weddings
#detail_decorate_root .magic-0{border-bottom-width:2px;border-bottom-style:solid;border-bottom-color:#53647a;background-color:#c5ccde;margin-left:0;margin-right:0;padding-left:8px;padding-right:8px;color:#53647a;font-family:Roboto;font-size:24px;padding-top:8px;padding-bottom:4px}#detail_decorate_root .magic-1{width:750px;border-collapse:collapse}#detail_decorate_root .magic-2{min-height:28px;padding:5px 10px;overflow:hidden;width:166px;min...
PUJIANG SAIXIN DECOR LLC
Verified Supplier
208 HengSheng Road,Pujiang ,Zhejiang ,China
Hot sale wedding decoration real wax flicke moving flame LED pillar candle with glass cups
#detail_decorate_root .magic-0{border-bottom-width:2px;border-bottom-style:solid;border-bottom-color:#53647a;background-color:#c5ccde;margin-left:0;margin-right:0;padding-left:8px;padding-right:8px;color:#53647a;font-family:Roboto;font-size:24px;padding-top:8px;padding-bottom:4px}#detail_decorate_root .magic-1{width:750px;border-collapse:collapse}#detail_decorate_root .magic-2{min-height:18px;padding:5px 10px;overflow:hidden;width:166px;min...
PUJIANG SAIXIN DECOR LLC
Verified Supplier
208 HengSheng Road,Pujiang ,Zhejiang ,China
Purity 99% Angiotensin II 68521-88-0 Angiotensin 2 Raw Powder Hot Sale
Pharmaceutical Chemical Peptide Angiotensin II Human Acetate Salt CAS 68521-88-0 Angiotensin II is an octapeptide that is a potent but labile vasoconstrictor. It is produced from angiotensin I after the removal of two amino acids at the C-terminal by ANGIOTENSIN CONVERTING ENZYME. The amino acid in position 5 varies in different species. To block VASOCONSTRICTION and HYPERTENSION effect of angiotensin II, patients are often treated with ACE...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
PCB Handling Equipment with Brush Sticker Roller PCB Cleaning Machine
PCB Handling Equipment with Brush Sticker Roller PCB Cleaning Machine Introduction This In-line PCB Surface clean machine used for PCB before printing solder paste and red glue to remove surface small chip , dust,fiber,hair,skin debris and metal particles etc.other things.Eliminate PCB board static to reduce the bad printing and foreign object caused cold welding ,missing weld,camber and deflection welding, improve products quality .Greatly...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Submit “hot wax hair removal” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
