China Categories
English
Home /

hot sale 2013

1 - 10 Results for hot sale 2013 from 56045 Products

Hot Sale Automatic Soldering Robot for General Performance Home Appliances

China Hot Sale Automatic Soldering Robot for General Performance Home Appliances on sale
High Precision Solder Robot with Auto Cleaning & Iron Head Alignment Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's product...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China

Hot Sales Wedding Half Circle Arch Light Wedding Chandelier Stand For Wedding Props Event Decor

China Hot Sales Wedding Half Circle Arch Light Wedding Chandelier Stand For Wedding Props Event Decor on sale
Product name: Hot Sales Wedding Half Circle Arch Light Wedding Chandelier Stand For Wedding Props Event Decor Material: Crystal/Metal Decoration: Wedding/Event Package: 1 Piece/1Carton,Safe Packages,Good foam with carton Size: H:300cm*W:120cm Color: Black/White/Gold/silver,all other color Smple: Avaliable MOQ: 10 Pcs ​...
PUJIANG SAIXIN DECOR LLC
Verified Supplier
208 HengSheng Road,Pujiang ,Zhejiang ,China

SX-CH237 Hot Sale Cheap K9 Crystal Chandeliers For Wedding Props Event Decor

China SX-CH237 Hot Sale Cheap K9 Crystal Chandeliers For Wedding Props Event Decor on sale
Product Name: SX-CH237 Hot Sale Cheap K9 Crystal Chandeliers For Wedding Props Event Decor Material: Crystal/Metal Decoration: Wedding/Event Package: 1 Piece/1Carton,Safe Packages,Good foam with carton Size: H:120cm*W:80cm,any other size can be customize Color: Black/White/Gold/silver,all other color Smple: Avaliable MOQ: 10 Pcs ​...
PUJIANG SAIXIN DECOR LLC
Verified Supplier
208 HengSheng Road,Pujiang ,Zhejiang ,China

Hot Sale Crystal With Gold Metal Desing Flower Stand For Wedding Centerpieces

China Hot Sale Crystal With Gold Metal Desing Flower Stand For Wedding Centerpieces on sale
Product name: Hot sale crystal with gold metal desing flower stand for wedding centerpieces Material: Metal/Glass Decoration: Wedding/Event Package: 1 Piece/1Carton,Safe Packages,Good foam with carton Size: H:108cm*W:30cm Color: Gold/Clear,Silver/Clear,all other color Smple: Avaliable MOQ: 10 Pcs ​...
PUJIANG SAIXIN DECOR LLC
Verified Supplier
208 HengSheng Road,Pujiang ,Zhejiang ,China

Hot sale product 12 inch A3 dtf printer printing machine I3200 XP600 dual heads DTF Printer

China Hot sale product 12 inch A3 dtf printer printing machine I3200 XP600 dual heads DTF Printer on sale
Product Description: DTF Printer Machine is a professional DTF printing equipment that provides users with high quality and long-lasting prints. It features an outer packing size of 110cm*84cm*119cm, 97cm*63cm*62cm and a printing width of A3/330MM, making it the perfect choice for large-scale printing applications. It is equipped with two print heads and supports CMYK, White and other inks, ensuring that you get the best color performance. In...
Shaoxing Licai Digital Technology Co., Ltd.
Verified Supplier
1, Building 2, China Textile City Creative Park, Keqiao District

Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity

China Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity on sale
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province

Hot Sale China Factory Supply Budesonid CAS 51333-22-3 Pulmicort With Safe Delivery

China Hot Sale China Factory Supply Budesonid CAS 51333-22-3 Pulmicort With Safe Delivery on sale
China Factory Supply Budesonid E CAS 51333-22-3 Pulmicort With Safe Delivery A non-halogenated glucocorticoid related to triamcinolone hexacetonide. Used as an antiinflammatory agent laxative, antineoplastic The oral capsule is used for the treatment of mild to moderate active Crohn's disease. The oral tablet is used for induction of remission in patients with active, mild to moderate ulcerative colitis. The oral inhalation formulation is used...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province

Purity 99% Angiotensin II 68521-88-0 Angiotensin 2 Raw Powder Hot Sale

China Purity 99% Angiotensin II 68521-88-0 Angiotensin 2 Raw Powder Hot Sale on sale
Pharmaceutical Chemical Peptide Angiotensin II Human Acetate Salt CAS 68521-88-0 Angiotensin II is an octapeptide that is a potent but labile vasoconstrictor. It is produced from angiotensin I after the removal of two amino acids at the C-terminal by ANGIOTENSIN CONVERTING ENZYME. The amino acid in position 5 varies in different species. To block VASOCONSTRICTION and HYPERTENSION effect of angiotensin II, patients are often treated with ACE...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province

BPC-157 Peptide 2mg / 5mg / 10mg Hot Sales High Purity China Factory Price Peptide

China BPC-157 Peptide 2mg / 5mg / 10mg Hot Sales High Purity China Factory Price Peptide on sale
BPC-157 Protein Peptide Hormones CAS 137525-51-0 2mg 10mg/Vial The pleiotropic beneficial effects of stable gastric pentadeceptide BPC157 have been reported in multiple organ systems. BPC157 is a natural gastric pentapeptide, which is non-toxic and has deep cytoprotective activity and has been used in ulcerative colitis and multiple sclerosis tests. In human gastric juices, ChemicalbookBPC157 is stable for more than 24 hours, so it has good oral...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province

Hot Sale Nonathymulin / Thymalin Peptide CAS 63958-90-7 With Safe Delivery

China Hot Sale Nonathymulin / Thymalin Peptide CAS 63958-90-7 With Safe Delivery on sale
English name Thymalin Cas number 63958-90-7 Synonyms pGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn;STF, SeruM ThyMic Factor, ThyMulin;L-Asparagine,5-oxo-L-prolyl-L-alanyl-L-lysyl-L-seryl-L-glutaminylglycylglycyl-L-seryl-;Pyr-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn-OH trifluoroacetate salt;Serum thymic factor (porcine);Thymic serum factor;Thymic serum factor (pig);PYR-ALA-LYS-SER-GLN-GLY-GLY-SER-ASN Purity 99% delivery 8-12days Delivery time Next day of payment...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Submit “hot sale 2013” inquiry
*From:
Your email address is incorrect!
To:
Shenzhen Hansome Technology Co., Ltd.
*Subject:
Your subject must be between 10-255 characters!
*Message:
Your message must be between 20-3,000 characters!
Yes! I would like your verified suppliers matching service!

This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!

Business license check OK