Business license check OK
1 - 10 Results for hair iron for sale from 13682 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Iron Head Alignment Solder Robot with Auto Cleaning & Iron Head Alignment
High Precision Solder Robot with Auto Cleaning & Iron Head Alignment Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's product...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
4Axis Soldering Robot with Auto Cleaning & Iron Head Alignment
High Precision Solder Robot with Auto Cleaning & Iron Head Alignment Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's product...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Automatic Soldering Machine with Auto Cleaning & Iron Head Alignment
High Precision Solder Robot with Auto Cleaning & Iron Head Alignment Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's product...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Solder Robot with Auto Cleaning & Iron Head Alignment
Taiwan Hiwin Linear Guide Solder Robot with Auto Cleaning & Iron Head Alignment Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
High Precision 4Axis Solder Robot with Automatic Cleaning and Iron Head Alignment
High Precision Solder Robot with Auto Cleaning & Iron Head Alignment Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's product...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
High Precision Solder Robot with Auto Cleaning & Iron Head Alignment
High Precision Solder Robot with Auto Cleaning & Iron Head Alignment Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's product...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Hot Sale Automatic Soldering Robot for General Performance Home Appliances
High Precision Solder Robot with Auto Cleaning & Iron Head Alignment Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's product...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Automatic Soldering Robot with Auto Cleaning amp Iron Head Alignment for High Precision Soldering
Advanced Automatic Soldering Robot for Semiconductor and General Consumer Goods Introduction This automatic desktop type soldering machine is a hot sale product, which using the teaching box for manual programing, adopt the high quality stepper motor and timing belt to driving the machine. The machine has the options for single or doulbe working station, also the traveling range standard is 300*300mm, it can be customized to fit customer's...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Submit “hair iron for sale” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
