Business license check OK
1 - 10 Results for ford truck part number lookup from 29435 Products
Forklift Parts Electronic Throttle Curtis ET-191E 24-48V Forklift Truck Accelerator
Forklift Parts Electronic Throttle Curtis ET-191E 24-48V Forklift Truck Accelerator Here is original elctronic throttle Curtis ET-191E for your note. If you need this throttle, please let us know the details below (1) Please confirm the part number. (2) Please send us the photos of the nameplate on your forklift. Then we are able to quote correct price to you. Product Show Product Name Electronic Throttle Model Number ET-191E Plug Water-proof...
Hefei Liftpart Machinery Technology Co., Ltd.
Verified Supplier
369 Logistics Park, Luming Shan Road, Yaohai Industry Area, Yaohai District, Hefei city, Anhui province, China.
Electronic Forklift Truck Motor Controller SET865L 80V 650A Black Color
Electronic Forklift Truck Motor Controller SET865L 80V 650A Black Color It is PG Brand Controller SET865L for your notice. Besides PG Controller, we also supply many other forklift controller, for example, Curtis Controller, Copy Curtis Controller, ZAPI Controller, SME Controller and so on. Kindly let us know your interested ones. Usually, we confirm a forklift controller according to factors below. (1) The model number of a controller. (2) The...
Hefei Liftpart Machinery Technology Co., Ltd.
Verified Supplier
369 Logistics Park, Luming Shan Road, Yaohai Industry Area, Yaohai District, Hefei city, Anhui province, China.
TCM Direction Sensor 76640012400 S-1865-0061 Used On Forklift Truck/ Pallet/Electric Jack
Black TCM Direction Sensor 76640012400 S-1865-0061 You are looking at TCM Sensor S-1865-0061. If you are in need for one of these, please offer us detailed information as below. (1) Pictures of the sensor. (2) Pictures of the nameplate on your applied forklift. As a result, we can confirm the order for sure and send you the right one. Thanks a million. Product Description Product Name Direction Sensor Part Number S-1865-0061 Applied Forklift...
Hefei Liftpart Machinery Technology Co., Ltd.
Verified Supplier
369 Logistics Park, Luming Shan Road, Yaohai Industry Area, Yaohai District, Hefei city, Anhui province, China.
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
CAS 52232-67-4 Cosmetic Peptide Teriparatide Acetate 98% Safe Delivery
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99%Min Assay Teriparatide Acetate Cosmetic Peptide CAS 52232-67-4 With Safe Custom
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3 19356-17-3
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Big Power Mining Truck Used XCMG Dump Truck Mining Tipper Truck for Mine Wide Body
Big Power Mining Truck Used XCMG Dump Truck Mining Tipper Truck for Mine Wide Body Specifications: 1.Certificate number WBY020K40000377 2.Date of issue 25-Apr-20 3.Manufacturer Xuzhou XCMG Automobile Manufacturing Co., LTD 4.Brand XCMG Off-highway wide-body dump truck 5.Model Number NXG5760D3T 6.vehicle identification number LC1ARMAF0K0000377 7.Color Yellow 8.Engine type WP12G430E310 9.Engine number 1419A007188 10.Fuel Diesel 11.Displacement/...
Zhengzhou Jaen Industry Co., Ltd
Yard No.5, Qiliyan Road, Erqi District, Zhengzhou, Henan, P.R.C.
Wide Body Mining Tipper Truck for Mine Big Power Mining Truck Used XCMG Dump Truck
Wide Body Mining Tipper Truck for Mine Big Power Mining Truck Used XCMG Dump Truck Specifications: 1.Certificate number WBY020K40000377 2.Date of issue 25-Apr-20 3.Manufacturer Xuzhou XCMG Automobile Manufacturing Co., LTD 4.Brand XCMG Off-highway wide-body dump truck 5.Model Number NXG5760D3T 6.vehicle identification number LC1ARMAF0K0000377 7.Color Yellow 8.Engine type WP12G430E310 9.Engine number 1419A007188 10.Fuel Diesel 11.Displacement/...
Zhengzhou Jaen Industry Co., Ltd
Yard No.5, Qiliyan Road, Erqi District, Zhengzhou, Henan, P.R.C.
5KW Webasto 12V diesel air heater for boat car ship truck marine
Working life 10 YEARS Voltage DC 12V Color Gary and black Application all vehicle Lumen/Kit Prking heater Certification CE E-mark Power 5000w Warranty 2 years Brand Belief MOQ 1 Piece Model Number FJH-5/1C Price USD 355 Gender Grade one Port Tianji or beijing Detailed Images Application Other Products air 2kw parking heater suit for 2-6 seats air 2.2kw heater suit for 2-6 seats air 4kw heater suit for 2-8 seats Our Service 1. OEM Manufacturing...
JP China Trade Int'l Co., Ltd.
1005 Jincheng Centre, Tongzhou District, Beijing China 101101
Submit “ford truck part number lookup” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
