Business license check OK
1 - 10 Results for express air cargo from 51408 Products
Shipping Air Sea Express Delivery Rear Upper Control Arms for BMW X5 E70 OE 33326770970
Shipping Air Sea Express Delivery Rear Upper Control Arms for BMW X5 E70 OE 33326770970 #detail_decorate_root .magic-0{border-bottom-style:solid;border-bottom-color:#53647a;font-family:Roboto;font-size:24px;color:#53647a;font-style:normal;border-bottom-width:2px;padding-top:8px;padding-bottom:4px}#detail_decorate_root .magic-1{margin-bottom:10px;line-height:0}#detail_decorate_root .magic-2{margin-bottom:0}#detail_decorate_root .magic-3{position...
Chengdu Xinlong Zhishi Auto Parts Co., Ltd.
Verified Supplier
566 Yongshun Road, Wuhou District
Shipping AIR SEA Express Delivery Cooling System Blower Fan Motor for BMW 5 X5 E39 E53
#detail_decorate_root .magic-0{border-bottom-style:solid;border-bottom-color:#53647a;font-family:Roboto;font-size:24px;color:#53647a;font-style:normal;border-bottom-width:2px;padding-top:8px;padding-bottom:4px}#detail_decorate_root .magic-1{margin-bottom:10px;line-height:0}#detail_decorate_root .magic-2{margin-bottom:0}#detail_decorate_root .magic-3{position:relative;width:100%}#detail_decorate_root .magic-4{width:750px;border-collapse:collapse}...
Chengdu Xinlong Zhishi Auto Parts Co., Ltd.
Verified Supplier
566 Yongshun Road, Wuhou District
Shipping Express Delivery Auto Part Air Conditioner Blower Motor OE 64119297752 For BMW
#detail_decorate_root .magic-0{border-bottom-style:solid;border-bottom-color:#53647a;font-family:Roboto;font-size:24px;color:#53647a;font-style:normal;border-bottom-width:2px;padding-top:8px;padding-bottom:4px}#detail_decorate_root .magic-1{margin-bottom:10px;line-height:0}#detail_decorate_root .magic-2{margin-bottom:0}#detail_decorate_root .magic-3{position:relative;width:100%}#detail_decorate_root .magic-4{width:750px;border-collapse:collapse}...
Chengdu Xinlong Zhishi Auto Parts Co., Ltd.
Verified Supplier
566 Yongshun Road, Wuhou District
Diesel Engine Parts ZEXEL S4K Excavator Injection Diesel Pump Assembly For CAT 303.5E CR 304E2 CR 305.5E2 CR
Diesel Engine Parts ZEXEL S4K Excavator Injection Diesel Pump Assembly For CAT 303.5E CR 304E2 CR 305.5E2 CR Product Details: Product Name: ZEXEL S4K Excavator Diesel Pump Type: Excavator Diesel Engine Parts Payment: L/C, D/A, D/P, T/T, Western Union, MoneyGram MOQ: 1 PCS Delivery Way: By Sea/ Air/ Express(FedEx, DHL, EMS, SF Express...) Packaging: PP bag, Carton, Wooden cx, or as Required Product Advantages of the ZEXEL S4K Excavator Diesel...
Guangzhou Huilian Machine Equipment Co., Ltd.
Verified Supplier
Room 107,No.1218, Zhongshan Ave., Tianhe, Guangzhou, China
Excavator Engine Parts V2403 fuel injector pump 25-39352-00 For CAT 303.5E2 CR CAT 305.5E2 CR CAT 308E2 CR SB
Excavator Engine Parts V2403 fuel injector pump 25-39352-00 For CAT 303.5E2 CR CAT 305.5E2 CR CAT 308E2 CR SB Product Details: Product Name: V2403 Fuel Injector Pump Type: Excavator Diesel Engine Parts Payment: L/C, D/A, D/P, T/T, Western Union, MoneyGram MOQ: 1 PCS Delivery Way: By Sea/ Air/ Express(FedEx, DHL, EMS, SF Express...) Packaging: PP bag, Carton, Wooden cx, or as Required Product Advantages of the V2403 Fuel Injector Pump: 1.Efficient...
Guangzhou Huilian Machine Equipment Co., Ltd.
Verified Supplier
Room 107,No.1218, Zhongshan Ave., Tianhe, Guangzhou, China
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
CAS 52232-67-4 Cosmetic Peptide Teriparatide Acetate 98% Safe Delivery
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99%Min Assay Teriparatide Acetate Cosmetic Peptide CAS 52232-67-4 With Safe Custom
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3 19356-17-3
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Best Price Calcifediol 25-Hydroxyvitamin D3 CAS 19356-17-3 With Safe Delivery
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Submit “express air cargo” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
