Business license check OK
1 - 10 Results for chemicals safe transport certificate from 28350 Products
CAS 544-17-2 Calcium Formate Modified Potato Starch Chemical Additives
CAS 544-17-2 Calcium Formate Modified Potato Starch Chemical Additives Safe Food Ingredients Basic Information Model Number : HMHT0259 Other Names : Formiate ammonia Molecular Formula : CH5NO2 Molecular Weight : 63 CAS NO. : 540-69-2 EINECS NO. : 208-753-9 Product Param Items Index Appearance and shape White crystal powder Melting point 115-120℃ Solubility Easily soluble in water, soluble in ethanol and ammonia Storage conditions Store at RT....
Wuxi High Mountain Hi-tech Development Co.,Ltd
Verified Supplier
No.1406, Building 3, Calxon Fortune Center, Financial 3rd Street, Jingkai District, Wuxi, P. R. of China
Pesticide Intermediates H3PO3 Chemical Additives Formula Phosphorous Acid strong hygroscopicity
Pesticide Intermediates Formula Phosphorous Acid Chemical Additives Basic Information Model Number : HMHT0040-7 Water absorption: strong hygroscopicity Molecular Formula: H3PO3 Boiling point: 200℃ Molecular Weight : 82.00 Melting point: 73℃ Other Names: PA ; PPA ;Phosphonic Acid ; Hydrogen Phosphonate Solubility: Easily soluble in water Packaging Types Packaging, Storage and Transportation: Three plywood drums for export packaging, lined with two...
Wuxi High Mountain Hi-tech Development Co.,Ltd
Verified Supplier
No.1406, Building 3, Calxon Fortune Center, Financial 3rd Street, Jingkai District, Wuxi, P. R. of China
99% Purity Dapagliflozin Powder CAS 61432-26-8 With Safe Shipping
High Quality Dapagliflozin CAS No. 461432-26-8 with Safe Shipping Dapagliflozin is a medication used to treat type 2 diabetes. It belongs to a class of drugs known as sodium-glucose co-transporter 2 (SGLT2) inhibitors. Dapagliflozin works by blocking the reabsorption of glucose by the kidneys, which leads to increased glucose excretion in the urine. By reducing the amount of glucose reabsorbed, dapagliflozin helps lower blood sugar levels in...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
PCB Handling Equipment Precision ESD Magazine Rack for Organized and Safe PCB Storage
PCB Handling Equipment Precision ESD Magazine Rack for Organized and Safe PCB Storage Introduction This PCB magazine racks are widely used in the PCB loader and unloader machine, suitable for transport, store and manage the PCBs in the PCB fabrication factories, it's a smart PCB storage system, the magazines take small room, but it can be stackable and store the PCBs convenient and ordered. The magazines are healthy products, which is Non-toxic,...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
CAS 52232-67-4 Cosmetic Peptide Teriparatide Acetate 98% Safe Delivery
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99%Min Assay Teriparatide Acetate Cosmetic Peptide CAS 52232-67-4 With Safe Custom
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Best Price Calcifediol 25-Hydroxyvitamin D3 CAS 19356-17-3 With Safe Delivery
Product Detail English name Calcifediol Cas number 19356-17-3 Melting point 74-76°C Density 1.01±0.1 g/cm3(Predicted) Storage -20°C DMF 20mg/ml Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: Supply High Quality Vitamin D Derivative Calcifediol with Best Price 63283-36-3/19356-17-3 Teriparatide Acetate cas 41294-56-8 image: Company Profile Xingtai Xinzhou...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Factory Price API Raw Material Vitamin D Calcitriol Powder CAS 32222-06-3 Calcitriol With Safe Delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Wholesale Nutrition Supplement Calcitriol CAS No 32222-06-3 Calcitriol with safe delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Wholesale Nutrition Supplement Calcitriol CAS No 32222-06-3 Calcitriol with safe delivery
Product Detail English name Calcitriol Cas number 32222-06-3 Melting point 119-121°C Density 1.0362 (rough estimate) Storage 2-8°C PKA 14.43±0.40(Predicted) Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT Description Calcitriol is the active form of vitamin D and is also a kind of hormones in the body. It plays an important role in the regulation of calcium and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Submit “chemicals safe transport certificate” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
Hot Products :
