Business license check OK
1 - 10 Results for best korean cosmetic product korea from 142945 Products
Cosmetic Raw Material Copper Peptide CAS 49557-75-7 Ghk-Cu Powder For Skin Care
Cosmetic Raw Material Copper Peptide CAS 49557-75-7 Ghk-Cu Powder for Skin Care Copper peptides are small protein fragments that contain copper ions. They are commonly used in skincare and cosmetic products for their potential benefits to the skin. Copper peptides have been studied for their ability to promote skin regeneration and collagen production. They are believed to stimulate the synthesis of extracellular matrix components, such as...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
SS 304/316 Stainless Steel Magnetic Multi Cartridge Bag Filter Housing Kyk Korea Water Filter
Water Treatment SS 304/316 Stainless Steel Magnetic Multi Cartridge Bag Filter Housing Kyk Korea Water Filter Core Components Pressure vessel Material Plywood Case Weight 5-30kg Size different as each model Productivity 3000L/Hour Weight (KG) 12kg Material SUS304 Type Clip type Application Food & Beverage Factory Model multi bags ordinary flange filter housing Specification(mm) 180*810 Thickness(mm) 1.2/2/3/4 Pressure 0.8mpa Technology Mirror...
Qingdao Crowns Machinery Co., Ltd.
Verified Supplier
Guangda International Building, Chaoyangshan Road, Huangdao District, Qingdao City, Shandong Province
0.3-0.5mm Thickness Cosmetic Teeth Covers Veneers For Cosmetic Dentistry
0.3-0.5mm Thickness Cosmetic Teeth Covers for Cosmetic Dentistry at Best *, *::before, *::after {box-sizing: border-box;}* {margin: 0;}html, body {height: 100%;}body {line-height: 1.5;-webkit-font-smoothing: antialiased;}img, picture, video, canvas, svg {display: block;max-width: 100%;}input, button, textarea, select {font: inherit;}p, h1, h2, h3, h4, h5, h6 {overflow-wrap: break-word;}ul, li, ol {padding: 0;list-style-position: inside;}.page...
Fotis Dental Laboratory
Verified Supplier
3A/F Tung Mei Garden Tung Chung District Lantau Island
Facory Price Cosmetic Peptide Melanotan Peptide Melanotan I / Mt-1 Peptide Powder / Melanotan-1 CAS 75921-69-6
Cosmetic Peptide Melanotan Peptide Melanotan I / Mt-1 Peptide Powder / Melanotan-1 CAS 75921-69-6 Product Name Cosmetic Peptide Melanotan Peptide Melanotan I / Mt-1 Peptide Powder / Melanotan-1 CAS 75921-69-6 CAS NO. 75921-69-6 Appearance White Powder Purity 99% Density 1.43 Solubility H2O: 5 mg/mL, soluble Acidity Coefficient (pKa) 13.00±0.70 Application Drug Peptide Usage Cosmetic Peptide Melanotan Peptide Melanotan I / Mt-1 Peptide Powder /...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Cosmetic Grade UV Absorber Bemotrizinol CAS 187393-00-6 Bemotrizinol
Cosmetic Grade UV Absorber Bemotrizinol CAS 187393-00-6 Bemotrizinol Product Name Bemotrizinol Purity ≥99% Colour Powder CAS NO. 187393-00-6 Molecular Formula C38H49N3O5 Molecular Weight 627.81 Boiling Point 782.0±70.0 °C(Predicted) Desity 1.109±0.06 g/cm3(Predicted) Melting Point 83-85°; mp 80° (Mongiat) Storage condition Refrigerator Xingtai Xinzhou Technology Co., LTD. Xingtai Xinzhou Technology Co., Ltd. was established in 2022 with strong...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Cosmetic Grade UV Absorber Bemotrizinol CAS 187393-00-6 with High Quality
Cosmetic Grade UV Absorber Bemotrizinol CAS 187393-00-6 with High Quality Product Name Bemotrizinol Purity ≥99% Colour Powder CAS NO. 187393-00-6 Molecular Formula C38H49N3O5 Molecular Weight 627.81 Boiling Point 782.0±70.0 °C(Predicted) Desity 1.109±0.06 g/cm3(Predicted) Melting Point 83-85°; mp 80° (Mongiat) Storage condition Refrigerator Xingtai Xinzhou Technology Co., LTD. Xingtai Xinzhou Technology Co., Ltd. was established in 2022 with...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Cosmetic Raw Material Copper Peptide CAS 49557-75-7 Ghk-Cu Powder for Skin Care
Copper Peptide CAS 49557-75-7 Ghk-Cu Powder for Skin Care high purity Copper peptides are small protein fragments that contain copper ions. They are commonly used in skincare and cosmetic products for their potential benefits to the skin. Copper peptides have been studied for their ability to promote skin regeneration and collagen production. They are believed to stimulate the synthesis of extracellular matrix components, such as collagen and...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99%Min Assay Semaglutide Cosmetic Peptide CAS 910463-68-2
Product Detail Boiling point 585.6±45.0°C(Predicted) Density 1.21±0.1g/cm3(Predicted) Solubility DMF:25mg/ml DMF:PBS(pH7.2Chemicalbook)(1:1):0.5mg/ml DMSO:2 0mg/mlEthanol:10mg/ml powder Acidity coefficient (pKa)9.85±0.19 (Predicted) Color Yellow Delivery Time: within 3 days after we get your payment Package: aluminum foil bag or as required Storage: Store in a cool and dry place and keep away from direct strong light Shipment: EMS, DHL, UPS,...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
CAS 52232-67-4 Cosmetic Peptide Teriparatide Acetate 98% Safe Delivery
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99%Min Assay Teriparatide Acetate Cosmetic Peptide CAS 52232-67-4 With Safe Custom
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Submit “best korean cosmetic product korea” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
