Business license check OK
1 - 10 Results for afro kinky human hair bulk from 11715 Products
Promote Hair Growth CAS-130-40-5 99% Purity Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Hot Food Additive CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt nutrient
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
99% Purity Nutrient Supplements CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Pharmaceutical veterinary medicine CAS-130-40-5 Riboflavin 5'-Monophosphate Sodium Salt 99% Purity
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
Vitamins CAS-130-40-5 99% Purity Raw Material Of Cosmetics Scientific Reagent
The main uses of riboflavin sodium phosphate are : 1, can promote cell development and regeneration; 2, can also promote the continued growth of hair, nails, skin; 3 can help prevent and eliminate oral Chemicalbook, tongue, lip inflammation, this inflammatory response is also known as oral reproductive syndrome; 4 can also help reduce eye fatigue, enhance vision; 5 can affect the absorption of iron by the human body. Name Riboflavin 5'-Monophosph...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
7A Grade Unprocessed Human Virgin Hair Peruvian Afro Kinky Curly Hair For Black Women
7A Grade Unprocessed Human Virgin Hair Peruvian Afro Kinky Curly Hair For Black Women Specification Brande Name Hakka Hair Material unprocessed Virgin Human Hair Texture Available Straight,body wave,loose wave,deep wave,water wave,kinky curly,italian curl etc. Grade Available Grade 7A Virgin Hair Hair Color Natural Black #1B (other colors can be customized) Hair Length 10”-30”in stock,other lengths can be customized Net Weight 100-105g, about 3.5...
Ellawigss
Verified Supplier
factory price afro kinky human hair weft
Please visit our official website: www.vhhiulove.com, you will find more details about human hair. factory price afro kinky human hair weft: 1) Material: 100% human hair, Virgin human hair weft 2) Quality: no shedding, no tangles, no lices, top quality hair 3) Malaysian hair weave Length:12"-28"available in stock. 4) Human hair Color: Natural Color,can be dyed to be any color. 5) Style: straight , body weave, loose weave factory price afro kinky...
TAIYUAN ZIJIJIA DETERGENT TECHNOLOGY CO.,LTD
best afro kinky human hair 24" human hair weft weave
Please visit our official website: www.vhhiulove.com, you will find more details about human hair. Best afro kinky human hair 24" human hair weft weave: Material 100% Chinese human hair Type Machine made weft; Clip in hair or Clip on hair; Length 8'' – 32'' Weight 100g/120g/160g or made according to your requirements Texture Silky straight, Body wave, Jerry , Water, Yaki, New Deep wave, Super wave,Light curl, Deep Curl, Loose curl,Afro curl,...
TAIYUAN ZIJIJIA DETERGENT TECHNOLOGY CO.,LTD
wholesale hair factory price afro kinky human hair weft
Please visit our official website: www.vhhiulove.com, you will find more details about human hair. wholesale hair factory price afro kinky human hair weft: 1) Material: 100% human hair, Virgin human hair weft 2) Quality: no shedding, no tangles, no lices, top quality hair 3) Malaysian hair weave Length:12"-28"available in stock. 4) Human hair Color: Natural Color,can be dyed to be any color. 5) Style: straight , body weave, loose weave wholesale...
TAIYUAN ZIJIJIA DETERGENT TECHNOLOGY CO.,LTD
Submit “afro kinky human hair bulk” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
