Business license check OK
1 - 10 Results for african american hair product from 37532 Products
8pcs Plastic Handle Travel Makeup Brush Set Synthetic Hair And Aluminium Ferrule With PVC Package Box
8pcs Plastic Handle Travel Makeup Brush Set ,Synthetic Hair And Aluminium Ferrule,Cosmetic Brushes With PVC Package Box Hair Synthetic hair Ferule Shiny aluminium Handle Plastic Color we can do as per clients' requests Logo Welcome put your logo on products Payment T/T, 30%deposit advance, balance collected before shipment. Package Poly bag/pcs Term EXW Shenzhen Sample Time 1-3 days by stock goods, 7-10 working days by unstock goods Delivery Time...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
4pcs Travel Makeup Brushes With 100% Synthetic Hair And Plastic Handle With Special Tail Handle
4pcs Travel Makeup Brushes With 100% Synthetic Hair And Plastic Handle , Cosmetic Brushes With Special Tail Handle Hair Synthetic hair Ferule Shiny aluminium Handle Shiny Plastic Color we can do as per clients' requests Logo Welcome put your logo on products Payment T/T, 30%deposit advance, balance collected before shipment. Package Poly bag/pcs Term EXW Shenzhen Sample Time 1-3 days by stock goods, 7-10 working days by unstock goods Delivery...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
7pcs Plastic Handle Professional Makeup Brushes With White Synthetic Hair Aluminium Ferrule
7pcs Plastic Handle Professional Makeup Brushes With White Synthetic Hair,Aluminium Ferrule Beauty Tools Hair Synthetic hair Ferule Shiny aluminium Handle Plastic Color we can do as per clients' requests Logo Welcome put your logo on products Payment T/T, 30%deposit advance, balance collected before shipment. Package Poly bag/pcs Term EXW Shenzhen Sample Time 1-3 days by stock goods, 7-10 working days by unstock goods Delivery Time About 30-35...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
Makeup Eyeshadow Brush With Aluminium Ferrule And Wooden Handle 100% Synthetic Hair OEM ODM
Makeup Eyeshadow Brush With Aluminium Ferrule And Wooden Handle,100% Synthetic Hair ,OEM And ODM Orders Are Welcome Product Description: This cosmestics brush set provides great value and capacity. It includes 5 face brushes and 5 eyeshadow brushes to meet your general daily makeup needs. Suitable for both makeup beginners and professionals. The premium synthetic make up brushes are made with soft and dense man-made fibers, providing a high...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
3pcs Eye Makeup Brush Customized Synthetic Hair And Plastic Handle PVC Packaging Box
3pcs Eye Makeup Brush Customized Travel Cosmetic Brush Synthetic Hair And Plastic Handle ,PVC Packaging Box Product Description: This cosmestics brush set provides great value and capacity. It includes 5 face brushes and 5 eyeshadow brushes to meet your general daily makeup needs. Suitable for both makeup beginners and professionals. The premium synthetic make up brushes are made with soft and dense man-made fibers, providing a high definition...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
4pcs Travel Makeup Brush Set With Synthetic Hair And Plastic Handle With PVC Packaging Box
4pcs Travel Makeup Brush Set With Synthetic Hair And Plastic Handle ,Cosmetic Brushes With PVC Packaging Box Product Description: This cosmestics brush set provides great value and capacity. It includes 5 face brushes and 5 eyeshadow brushes to meet your general daily makeup needs. Suitable for both makeup beginners and professionals. The premium synthetic make up brushes are made with soft and dense man-made fibers, providing a high definition...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
Single Makeup Brush Powder Brush Blush Brush With Synthetic Hair And Aluminium Ferrule Clear Plastic Handle
Single Makeup Brush Powder Brush Blush Brush With Synthetic Hair And Aluminium Ferrule,Clear Plastic Handle Product Description: This cosmestics brush set provides great value and capacity. It includes 5 face brushes and 5 eyeshadow brushes to meet your general daily makeup needs. Suitable for both makeup beginners and professionals. The premium synthetic make up brushes are made with soft and dense man-made fibers, providing a high definition...
Shenzhen EYA Cosmetic Co., Ltd.
Verified Supplier
B-3/F,Langjian Industrial Zone,Xinhu Rd,Niu Hu,Guanlan,Shenzhen,Guangdong,China 518110
Hot Sale Peptide Teriparatide Acetate Power CAS 52232-67-4 High Purity
Product Detail English name Teriparatide Acetate Cas number 52232-67-4 Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Purity 99% Delivery time within 48 hours Delivery 8-12 days Mode of transport Sea, air and truck transport Express delivery EMS,UPS,FedEx,DHL,TNT USES: A...
Xingtai Xinzhou Technology Co., Ltd
Verified Supplier
Tianyi Port community, Xiangdu District, Xingtai City, Hebei province
PCB Handling Equipment with Brush Sticker Roller PCB Cleaning Machine
PCB Handling Equipment with Brush Sticker Roller PCB Cleaning Machine Introduction This In-line PCB Surface clean machine used for PCB before printing solder paste and red glue to remove surface small chip , dust,fiber,hair,skin debris and metal particles etc.other things.Eliminate PCB board static to reduce the bad printing and foreign object caused cold welding ,missing weld,camber and deflection welding, improve products quality .Greatly...
Shenzhen Hansome Technology Co., Ltd.
Verified Supplier
3rd Floor,Building A,Sha Tang Bei Fang Yong Fa Industrial Area,Sha Jing, Bao an, Shenzhen, China
Submit “african american hair product” inquiry
This supplier has been verified by Everychina.com. Our verification process includes: 3 on-site visits by Everychina.com's service team!
Business license check OK
Hot Products :
hair salon for african american hair
shampoo for african american hair
moisturizer for african american hair
human hair for african american
american crew hair product
african american art for sale
african american wigs cheap
cheap african american wigs
black african american wigs
wholesale african american wigs
